KEGG   Brachybacterium faecium: Bfae_26800Help
Entry
Bfae_26800        CDS       T00965                                 

Definition
(RefSeq) uroporphyrinogen-III synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
bfa  Brachybacterium faecium
Pathway
bfa00860  Porphyrin and chlorophyll metabolism
bfa01100  Metabolic pathways
bfa01110  Biosynthesis of secondary metabolites
bfa01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bfa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Bfae_26800
Enzymes [BR:bfa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Bfae_26800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4
Motif
Other DBs
NCBI-GeneID: 8401225
NCBI-ProteinID: YP_003156043
UniProt: C7MH05
Position
2995276..2996058
Genome map
AA seq 260 aa AA seqDB search
MALSPAPRPVLVTRPAGRGASLLHLLEAQSVPAEHTPLVRLVPAEGEELAAARDRLADGA
HTHLVVTSRTAAEALGAVAVPEGTVVVAVGGGTAEALGAVGIPATLVAGGSGEALVAQMP
EADEGACVLFPASSAASRTVPEGLRAKGYRVHEVTAYRPERLEPPPAVAVALATGGYSAL
VLTSPMIARQAAAVGVHPSIPIITIGPPTSAAVRAAGLTPAREADETTDEALAAAVCEVL
ALPSAAPGGSTPSAGPGPQP
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atggccctctcccctgctccgcgtcccgtgctggtcacccgaccggccgggcgcggagcg
tcgctgctgcatctgctggaggcgcagagcgtccccgcggagcacaccccgctggtgcgc
ctggtcccggccgagggcgaggagctcgcggccgcccgtgaccggctcgcggacggtgcc
cacacgcacctggtggtcacctcccgcacggccgccgaggcgctcggcgcggtggccgtg
ccggagggcaccgtggtggtggccgtcggcggcggcaccgcggaggcgctgggcgcggtg
gggatcccggcgacgctggtcgcgggtggctcgggcgaggcgctcgtggcgcagatgccg
gaggccgacgagggggcgtgcgtgctgttccccgcgtcgtcggccgcctcccgcaccgtg
cccgaggggctgcgggcgaagggctaccgggtccatgaggtgacggcctaccggcccgag
cgcctcgagcccccgcccgcggtcgcggtggcgctggccaccggtgggtacagcgcgctc
gtgctcaccagtccgatgatcgcccgccaggccgcggcggtcggggtgcacccctcgatc
ccgatcatcaccatcggccctcccacctccgccgcggtgcgcgccgcggggctcacgccg
gcgcgcgaggcggacgagacgaccgacgaggcgctcgcggccgcagtgtgcgaggtgctg
gcgctcccgtcggccgctcccggtggctccacaccgtcggccggccccggcccgcagccc
tga

DBGET integrated database retrieval system