KEGG   Brachybacterium faecium: Bfae_26810Help
Entry
Bfae_26810        CDS       T00965                                 

Definition
porphobilinogen synthase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
bfa  Brachybacterium faecium
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bfa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Bfae_26810
Enzymes [BR:bfa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Bfae_26810
Exosome [BR:bfa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Bfae_26810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2996176..2997198
Genome map
AA seq 340 aa AA seqDB search
MTLPTFPGPIDRPRRLRTSTAMRSLVREHTLRPADLVLPMFVREGATENRPVSSMPGVEQ
HTLDSLARAATEAVERGVGGVMLFGVPEHKDAVGSGATDPEGILNRALARLRSELGDSTV
IMADLCLDEFTDHGHCGVLDDAGRVDNDATLGRYREMALAQAEAGAHLLGPSGMMDGQIA
AVRDALDSAGHQDTAVYAYTAKYASAFYGPFREAVDSSLQGDRRTYQQDPANGREALREL
ELDVAEGADLVMVKPGLPYLDVLREISGASPVPVGAYQVSGEYAMIEAAAANGWIDRDRT
VLESLLAFRRAGASTVLTYYASEVAGWYRDGLPPHLREFL
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgaccctcccgaccttccccggcccgatcgatcgcccgcgccggctgcgcacgagcacc
gcgatgcgctccctggtgcgcgagcacacgctgcgcccggcggatctcgtgcttccgatg
ttcgtgcgcgagggcgcgacggagaaccgccccgtctcctcgatgcccggcgtcgagcag
cacactctggactccctggcccgcgccgcgaccgaggcggtggagcgcggcgtgggcggc
gtgatgctcttcggcgtgcccgagcacaaggacgccgtcggctccggcgccaccgatccg
gaggggatcctcaaccgggccctcgcccggctgcgctcggagctcggcgactcgacggtg
atcatggccgacctgtgcctggacgagttcaccgaccacggccactgcggggtgctcgat
gacgcggggcgggtcgacaacgacgcgaccctcgggcgctaccgggagatggcgctcgcc
caggccgaggcgggcgctcacctgctgggcccctccgggatgatggacggccagatcgcc
gcggtccgtgacgccctcgactccgccgggcaccaggacaccgccgtgtacgcgtacacc
gcgaagtacgcctccgcgttctacgggccgttccgcgaggcggtggactcgtccctgcag
ggcgatcgccgcacctaccagcaggatccggccaacggccgcgaggcgctgcgggagctc
gagctcgacgtggccgagggcgcggacctcgtgatggtcaagccgggcctgccctacctc
gatgtgctgcgcgagatcagcggcgcctccccggtgccggtgggggcctaccaggtctcc
ggcgagtacgcgatgatcgaggcggcggcggcgaacggctggatcgaccgcgaccgcacc
gtgctggagtccctgctggccttccgccgcgccggcgcttcgacggtgctgacctactac
gcgagcgaggtcgccggctggtaccgcgacggcctgcccccgcacctgcgcgagttcctc
tga

DBGET integrated database retrieval system