KEGG   Brachybacterium faecium: Bfae_26890Help
Entry
Bfae_26890        CDS       T00965                                 

Definition
Dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
bfa  Brachybacterium faecium
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bfa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Bfae_26890
Enzymes [BR:bfa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     Bfae_26890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3005514..3006491
Genome map
AA seq 325 aa AA seqDB search
MNNSDDESAAGRPPLADSTVSRRSGPTLDAASGPTAATVPSAPRPLPDTSRRVLVMGIVN
RTRDSFFDEGRTWALDAAVAAGLEAAEDGADLIDVGGVKFAPGEALPVEEEIERVTPVLE
ALRRELPGHVRLSVDTFHAPVARAALEVGADLINDTTGLSDPQMAATVAETGASLVITHS
LAQPRRPYAHPRYEDVVQEVRAFLADRLDRALAAGIPRERIVLDPGPDLNKNTEQTLEML
RDWHEYASLGLPLLAALSRKDFVGESLGLPKQDRLEGSLAAAAWTIRHGARILRVHDVRA
TVRMARMLEVLAGWRDPAGPLVHNV
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgaacaacagcgacgacgagagtgcggcaggccgtcctcccctggcggattccactgta
tcccgcagatccggaccgacgctggacgccgcctcagggccgacggcggcaaccgtgccg
agcgctccccgaccgctgccggacacctcccgccgggtgctcgtgatgggcatcgtcaac
cgcacccgggactccttcttcgacgagggccgcacctgggctctggacgccgccgtggcc
gcggggctcgaggcggcggaggacggcgccgacctcatcgacgtgggcggcgtgaagttc
gccccgggcgaggcgctgcccgtcgaggaggagatcgagcgggtgaccccggtgctcgag
gcgctgcgccgggagctgcccgggcacgtgcggctctcggtcgacaccttccacgcgccc
gtcgcccgcgccgcgctcgaggtgggcgcggacctcatcaacgacaccaccgggctctcg
gacccgcagatggccgcgaccgtcgccgagaccggcgcctcgctggtcatcacccactcg
ctcgcgcagccgcgccgcccctacgcccacccgcgctacgaggacgtggtccaggaggtg
cgcgcgttcctcgccgaccggctggaccgcgccctcgcggccggcatcccgcgcgagagg
atcgtgctggacccgggcccggacctgaacaagaacaccgagcagaccctcgagatgctg
cgcgactggcacgagtacgcctcgctcggcctgccgctgctcgccgcgctgtcccgcaag
gacttcgtgggcgaatccctcggcctgcccaagcaggaccgcctcgagggatccctcgcc
gcggccgcctggacgatccgccacggcgcccggatcctgcgcgtccacgacgtgcgcgcc
acggtgcggatggcgcgcatgctcgaggtgctcgccggctggcgggatccggccgggccg
ctggtgcacaacgtgtga

DBGET integrated database retrieval system