KEGG   Brachybacterium faecium: Bfae_28430Help
Entry
Bfae_28430        CDS       T00965                                 

Definition
DNA replication and repair protein RecR
Orthology
K06187  
recombination protein RecR
Organism
bfa  Brachybacterium faecium
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bfa00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Bfae_28430
DNA repair and recombination proteins [BR:bfa03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Bfae_28430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3196780..3197373)
Genome map
AA seq 197 aa AA seqDB search
MYEGIVQDLIDELGRLPGIGPKSAQRIAFHLLDADDAAVRRLAEVLIQVKDTVRFCEICG
NVSAEEKCRICTDPRRTDEVICVVEESKDIVAIEKIREFKGRYHVLGGAIDPIGGVGPND
LRITQLMSRLGSGETTEVILALDPNIEGEATAAYLSRLLGPMELTVTRLASGLPVGGDLD
YADEMTLGRAFLGRRSV
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
gtgtacgaaggcatcgtccaggacctcatcgacgagctcggcaggctgccgggcatcggc
cccaagtcggcgcagcggatcgcattccatctgctggacgccgacgacgccgctgtgcgc
cgactcgcggaggtgctcatccaggtgaaggacacggtgcgcttctgcgagatctgcggc
aacgtctccgcggaggagaagtgccgcatctgcaccgacccgcgccgcaccgacgaggtg
atctgcgtggtcgaggagtccaaggacatcgtcgcgatcgagaagatccgcgagttcaag
ggccgctaccacgtgctcggcggcgccatcgacccgatcggcggcgtcggccccaacgac
ctgcgcatcacccagctgatgagccggctcggctccggggagaccaccgaggtgatcctc
gcgctggacccgaacatcgagggcgaggccaccgccgcctacctctcgcgcctgctcggg
ccgatggagctgaccgtcacccgcctcgcctccgggctgcccgtcggcggcgatctcgac
tacgccgacgagatgaccctgggcagagccttcctgggccggcgcagcgtctga

DBGET integrated database retrieval system