KEGG   Brachybacterium faecium: Bfae_29380Help
Entry
Bfae_29380        CDS       T00965                                 

Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
bfa  Brachybacterium faecium
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:bfa00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:bfa00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3314322..3314849
Genome map
AA seq 175 aa AA seqDB search
MSPAEERPQIAMIWAQARGGVIGAGGTMPWHLPEDLKHFSRTTTGSPVVMGRRTWESFPP
KYRPLPGRTNIVITRDDELELPGAVRARSLPEALELAASVAGPGTTTWVIGGGAIYADAI
GVAEQLVVTEIDLAVDGDTLAPRIPEDFTLAGADPAEGWHEGAGGLRYRILTYRR
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgagcccggccgaggagcgcccgcagatcgcgatgatctgggcgcaggcccgcggcggc
gtgatcggggccggcggcaccatgccctggcacctgccggaggacctgaagcacttctcc
cgcaccaccacgggctcccccgtcgtgatgggccggcgcacctgggagtccttcccgccg
aagtaccgtcccctgccgggacgcaccaacatcgtcatcacccgcgacgacgagctcgag
ctgcccggggcggtgcgggcgcgctccctgccggaggccctcgagctcgccgcctccgtc
gcaggcccgggcaccaccacctgggtgatcgggggcggcgcgatctacgccgacgcgatc
ggcgtcgccgagcagctggtcgtcaccgagatcgacctcgcggtggacggcgacaccctg
gcgccccgaatccccgaggacttcaccctggccggcgccgatccggcggagggctggcac
gagggggccggcggcctgcgctaccgcatcctcacctaccgccgctga

DBGET integrated database retrieval system