KEGG   Brachybacterium faecium: Bfae_29380Help
Entry
Bfae_29380        CDS       T00965                                 

Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
bfa  Brachybacterium faecium
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bfa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Bfae_29380
   00670 One carbon pool by folate
    Bfae_29380
Enzymes [BR:bfa01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     Bfae_29380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3314322..3314849
Genome map
AA seq 175 aa AA seqDB search
MSPAEERPQIAMIWAQARGGVIGAGGTMPWHLPEDLKHFSRTTTGSPVVMGRRTWESFPP
KYRPLPGRTNIVITRDDELELPGAVRARSLPEALELAASVAGPGTTTWVIGGGAIYADAI
GVAEQLVVTEIDLAVDGDTLAPRIPEDFTLAGADPAEGWHEGAGGLRYRILTYRR
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgagcccggccgaggagcgcccgcagatcgcgatgatctgggcgcaggcccgcggcggc
gtgatcggggccggcggcaccatgccctggcacctgccggaggacctgaagcacttctcc
cgcaccaccacgggctcccccgtcgtgatgggccggcgcacctgggagtccttcccgccg
aagtaccgtcccctgccgggacgcaccaacatcgtcatcacccgcgacgacgagctcgag
ctgcccggggcggtgcgggcgcgctccctgccggaggccctcgagctcgccgcctccgtc
gcaggcccgggcaccaccacctgggtgatcgggggcggcgcgatctacgccgacgcgatc
ggcgtcgccgagcagctggtcgtcaccgagatcgacctcgcggtggacggcgacaccctg
gcgccccgaatccccgaggacttcaccctggccggcgccgatccggcggagggctggcac
gagggggccggcggcctgcgctaccgcatcctcacctaccgccgctga

DBGET integrated database retrieval system