KEGG   Brachybacterium faecium: Bfae_30390Help
Entry
Bfae_30390        CDS       T00965                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
bfa  Brachybacterium faecium
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:bfa00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Bfae_30390
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Bfae_30390
Enzymes [BR:bfa01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Bfae_30390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3433502..3434023
Genome map
AA seq 173 aa AA seqDB search
MGPMTTLADFTATTITGQDQQLAEHLGSVVLVVNTASKCGLTPQYAGLQALHERFHEQGL
TVLGFPCDQFMHQEPGTEEEISEFCQVNYGVSFPMFAKVEVNGEGAHPLFQWLTGPHTPG
GDVPDSEIPGGDIEWNFAKFLLGRDGTVLRRYAPQVEPADLAEDIEEALAAGV
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atgggtcccatgacgactctcgccgacttcaccgccaccacgatcaccggccaggaccag
cagctcgccgagcatctggggtccgtcgtgctcgtggtcaacaccgccagcaagtgcggc
ctcacgccccagtacgccgggctccaggcgctgcacgaacggttccacgagcagggcctg
acggtgctcggcttcccgtgcgaccagttcatgcatcaggagccgggcacggaggaggag
atctccgagttctgccaggtcaactacggggtctccttcccgatgttcgcgaaggtcgag
gtgaacggggagggtgcgcatccgctgttccagtggctcaccggcccgcacacccccggc
ggggacgtgcccgacagcgagatccccggcggggacatcgagtggaacttcgcgaagttc
ctgctgggccgtgacggcaccgtgctgcgccgctacgcgccgcaggtggagcccgccgac
ctcgccgaggacatcgaggaggctctcgccgccggggtctga

DBGET integrated database retrieval system