KEGG   Bacteroides fragilis 638R: BF638R_0057Help
Entry
BF638R_0057       CDS       T01691                                 

Definition
putative 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (HPPK)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
bfg  Bacteroides fragilis 638R
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bfg00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BF638R_0057
Enzymes [BR:bfg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     BF638R_0057
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
58970..59431
Genome map
AA seq 153 aa AA seqDB search
MKVYLGLGTNLGDKELNLRVALQKIEERIGKIISLSAFYATAPWGFQSENNFLNAAVGVE
TVLSPVGILESTQRIEQEIGRLHKSRDGVYSDRLIDIDLLLYGDKILQDERLIVPHPLMT
DRKFVLEPLAEIAPDVVHPVFHKTIKELFLALS
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtatatttgggattaggtaccaacttgggtgataaggagctaaatcttcgtgtt
gccctacaaaaaatagaggagcggatagggaaaatcatttctctttccgctttttatgct
actgctccctggggatttcaatcggaaaacaactttctgaatgctgcggtgggagtggag
acagtattgtcccctgtcgggatactggaaagtactcaacggatagagcaggaaataggg
cgtttgcataaatcacgggacggtgtgtatagtgaccgcctgattgacattgatcttttg
ctctatggcgataagatactacaggatgaaaggcttatagtgcctcatccgttgatgacc
gaccgtaagtttgttctggaaccccttgccgagattgcaccggacgttgttcatccggtg
tttcataagacgattaaagagctatttctggctctttcgtga

DBGET integrated database retrieval system