KEGG   Bacteroides fragilis 638R: BF638R_0061Help
Entry
BF638R_0061       CDS       T01691                                 

Definition
uroporphyrinogen-III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
bfg  Bacteroides fragilis 638R
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bfg00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BF638R_0061
Enzymes [BR:bfg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     BF638R_0061
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
62666..63418
Genome map
AA seq 250 aa AA seqDB search
MKIKKVLVSQPKPASEKSPYYDIAEKYGVKIDFRPFIKVESVSAKEFRQQKVSILDHTAV
IFTSRHAIDHFFHLCTELRVTIPETMKYFCVTEAVALYIQKYVQYRKRKIFFGATGKIED
LIPSIVKHKTEKYLVPMSDVHNDDVRDLLDKNNIQHTECVMYRTVSNDFMEGEEFDYDML
VFFSPAGVSSLKKNFPDFDQKDIKIGTFGSTTAQAVRDAGLRLDLEAPNVKAPSMTAALD
LFIKENNKGK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaattaagaaagtattagtgtcgcagccaaagcctgcttcagagaaatctccttat
tacgacattgctgaaaagtatggtgtaaaaatagatttccgcccctttatcaaggttgag
agcgtctctgcgaaagaattcagacaacagaaagtatctattttagatcatacggctgtt
atatttacatcgcgtcatgcgattgatcatttcttccatctttgtacggagttgcgtgtg
acgatccctgagacgatgaagtatttctgtgtaacagaagctgttgctctttatattcag
aagtatgtgcagtatcgtaagcgtaagatcttctttggtgctacgggcaagatcgaggat
ctgattccttcgattgtgaaacataaaacagaaaagtatctcgtcccgatgtcggatgta
cacaacgatgacgtgagggatctgctggataaaaataacatccagcatacggaatgcgta
atgtatcgcactgttagcaatgactttatggagggagaggagtttgattatgatatgttg
gtattctttagtcctgccggagtatcttcgctgaagaagaacttccctgattttgatcag
aaggacattaagatcggaacattcggatcgactacagcacaagctgttcgtgatgccgga
ctccgtcttgatcttgaagcacctaacgtgaaagctccttcaatgacggctgccctcgat
ttgtttattaaggaaaacaataaaggaaaataa

DBGET integrated database retrieval system