KEGG   Bacteroides fragilis 638R: BF638R_0166Help
Entry
BF638R_0166       CDS       T01691                                 

Gene name
pfkA2
Definition
(GenBank) putative 6-phosphofructokinase 2
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
bfg  Bacteroides fragilis 638R
Pathway
bfg00010  Glycolysis / Gluconeogenesis
bfg00030  Pentose phosphate pathway
bfg00051  Fructose and mannose metabolism
bfg00052  Galactose metabolism
bfg00680  Methane metabolism
bfg01100  Metabolic pathways
bfg01110  Biosynthesis of secondary metabolites
bfg01120  Microbial metabolism in diverse environments
bfg01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bfg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BF638R_0166 (pfkA2)
   00030 Pentose phosphate pathway
    BF638R_0166 (pfkA2)
   00051 Fructose and mannose metabolism
    BF638R_0166 (pfkA2)
   00052 Galactose metabolism
    BF638R_0166 (pfkA2)
  Energy metabolism
   00680 Methane metabolism
    BF638R_0166 (pfkA2)
Enzymes [BR:bfg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     BF638R_0166 (pfkA2)
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     BF638R_0166 (pfkA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase Phage_sheath_1
Motif
Other DBs
NCBI-ProteinID: CBW20774
UniProt: E1WK53
Position
183377..184387
Genome map
AA seq 336 aa AA seqDB search
MKIGILTSGGDCPGINATIRGVCKTAINHYGMEVVGIHSGFQGLLTKEVESFTEKSLSGL
LNLGGTMLGTSREKPFRKQGIISDVDKPALIQRNIAELGLDCVVCIGGNGTQKTAAKFAA
MGINIVSVPKTIDNDIWGTDISFGFDSAVSIATDAIDRLHSTASSHKRVMVIEVMGHKAG
WIALYSGMAGGGDVILVPEIPYNIKNIGDTILNRLKKGKPYSIVVVAEGIQTDGRKRAAE
YIAQEIEYETGIETRETVLGYIQRGGSPTPFDRNLSTRMGGHATELIANGQFGRMIALKG
DEISSVALEEVAGKLKLVTEEHDLVVQGRRMGICFG
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaagatcggaattcttacatcaggcggcgattgccccggtataaacgctacaattcgt
ggggtatgcaaaacagctattaatcattacgggatggaagttgtagggattcacagtggt
tttcagggactgttgacgaaagaagtagaatcgtttactgaaaaatctttgtccggattg
ttgaatttaggcggtaccatgctgggaacttcgcgggagaaaccgtttcgtaagcaaggc
attatctcggatgtagataaacctgcgttaatacaacgtaatattgcagaattgggtctt
gattgtgtagtgtgtatcggggggaatggtacacagaaaaccgctgcaaagtttgctgcg
atgggaatcaatattgtttctgtgcccaaaacgatcgataacgatatctggggtaccgat
atctctttcggattcgactcggcagtgagtattgctacagatgctattgaccggcttcat
tccacggcgagttcgcacaaaagggtgatggtgatcgaggtgatgggacataaagccggt
tggattgctttatattcgggcatggcaggtggaggcgatgttattctggtaccggagata
ccttacaatattaaaaatataggagatacgattttaaatcgcttgaagaaaggaaaaccc
tattcgattgtagtggttgccgagggcatccagaccgatggacgtaaacgtgctgccgaa
tatattgctcaggagattgaatatgaaacgggtattgagacacgtgaaactgtattaggt
tatattcagcgtggtgggtcgcctacacctttcgaccgtaacttgtctacccgtatggga
ggacatgcaacagaactgatcgctaatggacagttcggtcgtatgattgctttgaaaggg
gatgagatatcttctgttgcattagaggaggtagccggaaagttgaagttggtgaccgag
gaacacgatcttgtggtgcagggacgccggatgggaatctgctttggataa

DBGET integrated database retrieval system