KEGG   Bacteroides fragilis 638R: BF638R_0166Help
Entry
BF638R_0166       CDS       T01691                                 

Gene name
pfkA2
Definition
putative 6-phosphofructokinase 2
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
bfg  Bacteroides fragilis 638R
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:bfg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BF638R_0166 (pfkA2)
   01230 Biosynthesis of amino acids
    BF638R_0166 (pfkA2)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BF638R_0166 (pfkA2)
   00030 Pentose phosphate pathway
    BF638R_0166 (pfkA2)
   00051 Fructose and mannose metabolism
    BF638R_0166 (pfkA2)
   00052 Galactose metabolism
    BF638R_0166 (pfkA2)
  Energy metabolism
   00680 Methane metabolism
    BF638R_0166 (pfkA2)
Enzymes [BR:bfg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     BF638R_0166 (pfkA2)
Protein phosphatases and associated proteins [BR:bfg01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     BF638R_0166 (pfkA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
183377..184387
Genome map
AA seq 336 aa AA seqDB search
MKIGILTSGGDCPGINATIRGVCKTAINHYGMEVVGIHSGFQGLLTKEVESFTEKSLSGL
LNLGGTMLGTSREKPFRKQGIISDVDKPALIQRNIAELGLDCVVCIGGNGTQKTAAKFAA
MGINIVSVPKTIDNDIWGTDISFGFDSAVSIATDAIDRLHSTASSHKRVMVIEVMGHKAG
WIALYSGMAGGGDVILVPEIPYNIKNIGDTILNRLKKGKPYSIVVVAEGIQTDGRKRAAE
YIAQEIEYETGIETRETVLGYIQRGGSPTPFDRNLSTRMGGHATELIANGQFGRMIALKG
DEISSVALEEVAGKLKLVTEEHDLVVQGRRMGICFG
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaagatcggaattcttacatcaggcggcgattgccccggtataaacgctacaattcgt
ggggtatgcaaaacagctattaatcattacgggatggaagttgtagggattcacagtggt
tttcagggactgttgacgaaagaagtagaatcgtttactgaaaaatctttgtccggattg
ttgaatttaggcggtaccatgctgggaacttcgcgggagaaaccgtttcgtaagcaaggc
attatctcggatgtagataaacctgcgttaatacaacgtaatattgcagaattgggtctt
gattgtgtagtgtgtatcggggggaatggtacacagaaaaccgctgcaaagtttgctgcg
atgggaatcaatattgtttctgtgcccaaaacgatcgataacgatatctggggtaccgat
atctctttcggattcgactcggcagtgagtattgctacagatgctattgaccggcttcat
tccacggcgagttcgcacaaaagggtgatggtgatcgaggtgatgggacataaagccggt
tggattgctttatattcgggcatggcaggtggaggcgatgttattctggtaccggagata
ccttacaatattaaaaatataggagatacgattttaaatcgcttgaagaaaggaaaaccc
tattcgattgtagtggttgccgagggcatccagaccgatggacgtaaacgtgctgccgaa
tatattgctcaggagattgaatatgaaacgggtattgagacacgtgaaactgtattaggt
tatattcagcgtggtgggtcgcctacacctttcgaccgtaacttgtctacccgtatggga
ggacatgcaacagaactgatcgctaatggacagttcggtcgtatgattgctttgaaaggg
gatgagatatcttctgttgcattagaggaggtagccggaaagttgaagttggtgaccgag
gaacacgatcttgtggtgcagggacgccggatgggaatctgctttggataa

DBGET integrated database retrieval system