KEGG   Bacteroides fragilis 638R: BF638R_0166Help
Entry
BF638R_0166       CDS       T01691                                 

Gene name
pfkA2
Definition
(GenBank) putative 6-phosphofructokinase 2
  KO
K21071  
ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
bfg  Bacteroides fragilis 638R
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bfg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BF638R_0166 (pfkA2)
   00030 Pentose phosphate pathway
    BF638R_0166 (pfkA2)
   00051 Fructose and mannose metabolism
    BF638R_0166 (pfkA2)
   00052 Galactose metabolism
    BF638R_0166 (pfkA2)
  Energy metabolism
   00680 Methane metabolism
    BF638R_0166 (pfkA2)
Enzymes [BR:bfg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     BF638R_0166 (pfkA2)
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     BF638R_0166 (pfkA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
183377..184387
Genome map
AA seq 336 aa AA seqDB search
MKIGILTSGGDCPGINATIRGVCKTAINHYGMEVVGIHSGFQGLLTKEVESFTEKSLSGL
LNLGGTMLGTSREKPFRKQGIISDVDKPALIQRNIAELGLDCVVCIGGNGTQKTAAKFAA
MGINIVSVPKTIDNDIWGTDISFGFDSAVSIATDAIDRLHSTASSHKRVMVIEVMGHKAG
WIALYSGMAGGGDVILVPEIPYNIKNIGDTILNRLKKGKPYSIVVVAEGIQTDGRKRAAE
YIAQEIEYETGIETRETVLGYIQRGGSPTPFDRNLSTRMGGHATELIANGQFGRMIALKG
DEISSVALEEVAGKLKLVTEEHDLVVQGRRMGICFG
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaagatcggaattcttacatcaggcggcgattgccccggtataaacgctacaattcgt
ggggtatgcaaaacagctattaatcattacgggatggaagttgtagggattcacagtggt
tttcagggactgttgacgaaagaagtagaatcgtttactgaaaaatctttgtccggattg
ttgaatttaggcggtaccatgctgggaacttcgcgggagaaaccgtttcgtaagcaaggc
attatctcggatgtagataaacctgcgttaatacaacgtaatattgcagaattgggtctt
gattgtgtagtgtgtatcggggggaatggtacacagaaaaccgctgcaaagtttgctgcg
atgggaatcaatattgtttctgtgcccaaaacgatcgataacgatatctggggtaccgat
atctctttcggattcgactcggcagtgagtattgctacagatgctattgaccggcttcat
tccacggcgagttcgcacaaaagggtgatggtgatcgaggtgatgggacataaagccggt
tggattgctttatattcgggcatggcaggtggaggcgatgttattctggtaccggagata
ccttacaatattaaaaatataggagatacgattttaaatcgcttgaagaaaggaaaaccc
tattcgattgtagtggttgccgagggcatccagaccgatggacgtaaacgtgctgccgaa
tatattgctcaggagattgaatatgaaacgggtattgagacacgtgaaactgtattaggt
tatattcagcgtggtgggtcgcctacacctttcgaccgtaacttgtctacccgtatggga
ggacatgcaacagaactgatcgctaatggacagttcggtcgtatgattgctttgaaaggg
gatgagatatcttctgttgcattagaggaggtagccggaaagttgaagttggtgaccgag
gaacacgatcttgtggtgcagggacgccggatgggaatctgctttggataa

DBGET integrated database retrieval system