KEGG   Bacteroides fragilis 638R: BF638R_0460Help
Entry
BF638R_0460       CDS       T01691                                 

Gene name
glsA
Definition
(GenBank) putative glutaminase
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
bfg  Bacteroides fragilis 638R
Pathway
bfg00220  Arginine biosynthesis
bfg00250  Alanine, aspartate and glutamate metabolism
bfg00471  D-Glutamine and D-glutamate metabolism
bfg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bfg00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BF638R_0460 (glsA)
   00220 Arginine biosynthesis
    BF638R_0460 (glsA)
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    BF638R_0460 (glsA)
Enzymes [BR:bfg01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     BF638R_0460 (glsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaminase
Motif
Other DBs
NCBI-ProteinID: CBW21056
UniProt: E1WKP3
Position
548512..549477
Genome map
AA seq 321 aa AA seqDB search
MDKKISISQIKEVVQQAYEQVKGNTGGKNADYIPYLANIDKNLFGISVCLLNGQTITVGD
FDYRFGIESVSKVHTAILILRQYGAQKVLEMIGADATGLPFNSIIAILLENDHPSTPLVN
AGAISACSMVTPIGNSDKKWDAIVQNITDLCGSAPQLIEELYKSETATNFNNRSIAWLLK
NYNRIYDDPNMSLDLYTRQCSLGVTAQMLSVAAGTVANGGVNPVTKKQVFDAELTPKITS
MIATVGFYEHSGDWMYTSGIPAKTGVGGGVMGVLPGVFGVSAFAPPLDGSGNSVKAQLAI
KYIMNKLGLNVFNGARVTIVD
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atggacaaaaaaatatctatttcccaaataaaagaggttgtgcagcaggcctacgaacag
gtaaagggtaatacaggcggtaagaatgccgattatattccttatctggccaatatagac
aaaaacctttttggtatcagtgtctgcctgctgaacggtcagaccattaccgtgggtgac
tttgattatcgtttcggtattgaatccgtatctaaagtgcatacagccattctgattctc
cgccaatacggggcacagaaagtgcttgagatgatcggtgcggatgctaccggacttcct
tttaactctatcattgccatcttgttggagaatgaccatccgtctactccgttggtaaat
gccggagccatctcggcttgttccatggtgactccgattggtaattcagataagaaatgg
gacgctatcgtacagaacattaccgatctttgcggttctgctccacagttgatcgaagaa
ctctataagtcggagacagctaccaatttcaataaccgttctattgcctggttactgaag
aactataatcgtatctatgacgatcccaatatgtcactggacctttatactcgccagtgc
tctttgggggtaactgcacagatgttgtcggtggctgccggtacggttgccaatggcggt
gtgaatcctgtgactaaaaagcaggtgttcgatgccgaactgactcctaaaatcacatct
atgattgctaccgtaggcttctacgaacattcgggcgactggatgtatacttcaggtatt
cctgccaagaccggtgtaggtggtggtgtgatgggagtattgccgggtgtattcggtgta
tctgcctttgctcctcctttggatggctcgggcaactcggtgaaagcacagttggccatt
aagtacatcatgaacaaattgggattgaatgtattcaatggtgcgagagtgaccatcgtc
gattag

DBGET integrated database retrieval system