KEGG   Bacteroides fragilis 638R: BF638R_0462Help
Entry
BF638R_0462       CDS       T01691                                 

Gene name
folP
Definition
putative dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
bfg  Bacteroides fragilis 638R
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:bfg00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
551690..552550
Genome map
AA seq 286 aa AA seqDB search
MDSTIFKSLNVNGRLLDLSIPQVMGILNVTPDSFYAGSRSRTEADIAARARQILDEGASM
IDIGAYSSRPNAEHISPEEEMRRLRTGLEILNRNHPGAIISVDTFRAGVAEECVKEYGVA
IINDISAGEMDEQMFPTVARLNVPYIMMHMQGTPQNMQKEPHYENLLKEVFIYFARKVQQ
LRDLGVKDIILDPGFGFGKTLEHNYELMAHLEEFGIFELPLLVGVSRKSMIYRLFGTTPQ
EALNGTTVLDTVALMKGADILRVHDVREAVESVRLIEKLKSVSACS
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atggattcaacgattttcaaaagcctgaatgtgaacggccgtttacttgatctttccatt
ccgcaggttatgggtatactcaatgttacacccgattctttttatgcaggtagccgaagc
cggacagaagccgatattgctgcacgtgcccgtcagatacttgatgaaggggcctctatg
attgatataggagcttattcgtcacgtccgaatgccgaacacatctcgcccgaagaagaa
atgcggcgtttgcgtaccggtctggaaatattgaaccggaatcatccgggtgctatcatt
tcagttgacacattccgtgccggagtggctgaggaatgcgtgaaggagtacggagtagct
attatcaatgacatttcggcgggtgagatggacgaacagatgtttccgacggtggctcgc
ctgaatgtaccttacattatgatgcacatgcaaggtactcctcaaaacatgcaaaaggag
ccccattatgaaaatttgctgaaagaggtcttcatctattttgcccgaaaagtacagcaa
ttgcgtgacttgggagtgaaagacattattctcgatcccggtttcggcttcggcaaaacg
ttggagcataactacgaactgatggcgcatctggaagagttcggcattttcgaacttccc
ttgttggtgggagtttcccgcaagtcgatgatttatcgtttgtttggaaccacaccgcag
gaagcactcaacgggacaacagtactcgatacggtagctttgatgaaaggtgccgatatt
ctccgtgtacatgatgtgcgtgaagctgtcgagtcggttcggctgatagagaaattaaaa
agtgtatcggcttgttcctga

DBGET integrated database retrieval system