KEGG   Bacteroides fragilis 638R: BF638R_0525Help
Entry
BF638R_0525       CDS       T01691                                 

Definition
(GenBank) putative Acyl-CoA synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bfg  Bacteroides fragilis 638R
Pathway
bfg00010  Glycolysis / Gluconeogenesis
bfg00620  Pyruvate metabolism
bfg00640  Propanoate metabolism
bfg00680  Methane metabolism
bfg01100  Metabolic pathways
bfg01110  Biosynthesis of secondary metabolites
bfg01120  Microbial metabolism in diverse environments
bfg01130  Biosynthesis of antibiotics
bfg01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bfg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BF638R_0525
   00620 Pyruvate metabolism
    BF638R_0525
   00640 Propanoate metabolism
    BF638R_0525
  Energy metabolism
   00680 Methane metabolism
    BF638R_0525
Enzymes [BR:bfg01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     BF638R_0525
Lipid biosynthesis proteins [BR:bfg01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   BF638R_0525
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: CBW21118
UniProt: E1WKV5
Position
complement(609646..611301)
Genome map
AA seq 551 aa AA seqDB search
MIDRFLSQTSFSSQEDFVKNLKIHVPDNFNFGYDIVDAWAAEQPDKPALLWTNDKGEHHQ
FSFADMKQYTDRTASYFQSLGIGHGDMVMLILKRRYEFWFSIIALHKLGAVVIPATHLLT
KKDIVYRCNAADIKMIVAAGEEVVTKHIIDAMPDSPTVKHLVSVGPEIPEGFDDFHQGIE
HAAPFVKPEHPNTNDDISLMYFTSGTTGEPKMVAHDFTYPLGHIVTGSFWHNLKENSLHL
TIADTGWGKAVWGKLYGQWIAGANVFVYDHEKFTPADILEKIQNYHVTSLCAPPTIFRFL
IHEDLTKYDLSSLEYCTIAGEALNPAVFDTFKKLTGIKLMEGFGQTETTLTVATFPWMEP
KPGSMGVPNPQYNVDLIDYEGRSVEAGEQGQIVIRTDKGKPLGLFKEYYRDASRTHEAWH
DGIYYTGDVAWKDEDGYLWFVGRADDVIKSSGYRIGPFEVESALMTHPAVVECAITGVPD
EIRGQVVKATIVLAKEYRERKGEDLVKELQNHVKKVTAPYKYPRVIEFVDELPKTISGKI
RRVEIRKNDEK
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atgatagatagatttttatctcaaacttccttcagttcacaggaagactttgtgaaaaac
ttaaagatacacgttccggacaacttcaacttcggatatgacatagtggatgcctgggct
gccgaacaaccagacaaaccggccttattatggactaatgacaaaggtgaacaccaccag
ttctcttttgcggatatgaaacaatatactgaccggacagcctcttattttcagagcctg
ggtatcggacatggtgatatggtcatgctgatattgaaacgacgctatgaattctggttc
agcatcattgccctgcacaaactaggggcagtcgttattccggctacacacctgctaacc
aagaaagacattgtataccgttgcaatgcagccgacataaaaatgattgtggctgccgga
gaagaagtggtcaccaaacacataatagatgctatgccggactctcctactgtaaagcat
ttagttagcgtagggcccgaaatacccgaaggatttgatgacttccatcagggcatcgag
catgcggcgcctttcgtaaagccggaacatccgaacaccaacgatgacatttcactgatg
tacttcaccagcggaacaaccggagagcctaagatggttgcacacgacttcacttatcca
ttggggcatatcgtaaccggtagtttctggcacaatctgaaagaaaacagcctccatctc
accattgccgacaccggctggggaaaagcagtgtggggaaagctctacggacaatggatt
gccggagcaaatgtattcgtgtatgatcatgaaaagttcactcctgccgatatattggaa
aagatacaaaattaccatgtcacttcactctgtgcccctcccaccattttccgtttcctc
atccacgaagacctgacgaaatatgacctttcgtcattggaatattgcaccattgcaggt
gaggccttgaatccggctgttttcgacacattcaaaaagttaacaggcatcaaactgatg
gaaggcttcgggcagaccgagactacactgacagtagccactttcccatggatggaaccc
aaaccgggaagtatgggggtgcccaatccacaatacaatgttgatctgatcgattacgaa
ggacggtcggtagaagccggagagcaaggacagatcgtaatccggactgacaaaggaaag
ccactgggactgttcaaagaatactatcgggacgcctcgcgtacacacgaagcatggcac
gacggaatatactacactggcgacgtagcctggaaagatgaagacggttatctatggttc
gtgggacgcgccgatgacgtaatcaaaagttccggttaccgtattggtccgttcgaagtg
gaaagtgcattgatgacacatcccgccgtagtagaatgtgccataaccggcgttcccgac
gaaatacgcggacaggtagtgaaagctaccatcgttctggccaaagagtatcgtgaacgc
aaaggggaagacttggtaaaagagctccagaatcatgtgaaaaaagtcacagctccttat
aaatatccacgcgtcatcgaatttgtcgacgaattgcctaagaccattagcggtaaaatc
cgacgagtggaaattcggaagaatgacgagaaataa

DBGET integrated database retrieval system