KEGG   Bacteroides fragilis 638R: BF638R_0546Help
Entry
BF638R_0546       CDS       T01691                                 

Gene name
aga
Definition
putative melibiase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
bfg  Bacteroides fragilis 638R
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:bfg00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:bfg00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:bfg00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(630737..632905)
Genome map
AA seq 722 aa AA seqDB search
MLKRTFILIGLVLSFCSLPAQELIQITTRNTALVFRVANQSLRQVYYGPRLADTDVLQKQ
GNNFPAYSTYGMGEQNEVALHAVHADGNTSTLLNFENVKQESPEPGITLTTISLKDPLYP
FQVKLFYKAYEESDLIEQWTIYQHTEKKPVTLYQFASAQLSFKSSSYRLTHFAGDWAGEC
NMSEVELTEGIKVIDSKLGTRATFFAHPMCLLSLNGRMTEDNGEVIGMALAWPANFKLEF
EKNNNQELRVLAGMNPYASHYKLKKGDVFQTPSFLYTYSTKGNGQVSRNFHRWARKYGLR
HGENSRYTLMNNWEATYFNFNEPKLKSIIEDAAGMGFELFLLDDGWFGQKHPRNNDDAGL
GDWVVNKEKLPNGLGWLVKQCTDNDIKFGIWVEPEMVNPQSELFDKHPDWVIQQLGREHI
LFRRQLVLDLSNPEVQEFVYKSVHDILKDNPQIAFVKWDCNRAVTNPGSTYLPADEQSHI
WIEYGRGLLNVFKKVRDSHPDVHFMLCSGGGGRLDYGSLRYFEEYWPSDNTDALQRILIQ
WGNSQFFPSIAMCCHVSASPNHQTGRTTPLKFRFDVAMQGALGMDLQPSTMNEKEVIFAK
EAIKTYESIRNIVFTGDLYRILSPYEGNRTSMMYVLPDKSRAVFYAYQLKSHIGEVSAPM
RFKGLIPDKKYNVKELNIYPGSRAATGSANGQSFSGDFLMNQGLPIGLSGDYSSAVIELE
QQ
NT seq 2169 nt NT seq  +upstreamnt  +downstreamnt
atgctaaaaagaacatttatattaatcggccttgtcctgagtttttgttcactgccagcg
caagaactgattcagattacgacacgcaacacagcacttgttttcagggttgccaatcaa
tcactaagacaagtttattatggcccacgcctggcagacaccgatgtattacagaaacag
ggcaataactttccggcatattcgacttatggaatgggagaacaaaacgaagtggccctt
catgcagtacatgcagacggtaatacctctacactactgaactttgaaaacgtgaaacaa
gagtctccggaacccggcataacactgactacgatttcactgaaagacccgctatatcct
tttcaagtgaaacttttctataaggcatacgaagagagcgaccttatagaacaatggact
atatatcagcatactgaaaagaaaccggtaacactttaccagtttgcttccgcacagctc
tcctttaaatcttcctcctaccgactcactcactttgccggtgactgggccggagaatgc
aacatgagtgaagtagaactgacagaaggcatcaaagtgatagattccaaattaggaacc
cgtgccacattctttgctcatcccatgtgtctgctatccctgaacggacggatgactgaa
gacaatggagaagtgatagggatggctctggcatggcctgccaactttaagttggaattt
gaaaaaaacaacaatcaggaactccgtgtacttgccggaatgaatccgtacgcatcacac
tacaaacttaaaaaaggcgatgtattccaaactccttcgttcctctacacatacagtaca
aaaggaaacggacaggtcagtcgtaatttccaccgttgggcacgtaaatatggtttacgc
cacggagaaaattcacgttataccctgatgaacaactgggaagccacttacttcaacttt
aacgaacccaaactgaaatcaattatagaagatgctgcagggatgggcttcgaactcttc
ctgctggacgacggatggtttggacagaaacatccccgcaacaatgatgacgcaggactt
ggcgactgggtggtaaacaaagaaaaacttcccaacggactgggatggctggtaaaacaa
tgtacggataatgatatcaagttcggtatctgggtggaacctgaaatggtaaacccccaa
agtgaactattcgataaacatcctgactgggtaatccagcaactgggacgtgaacatatt
ctctttcgccggcaactggtactcgacctgtcgaatcccgaagtacaagagtttgtatat
aagagtgtacacgacattctgaaagataaccctcagatagcttttgtgaaatgggactgt
aaccgtgctgtaaccaacccgggatccacttatttacctgccgacgaacagtcacacata
tggatcgaatacggacggggattactgaatgtttttaagaaagtacgcgattcacatccc
gacgtacactttatgctttgctctggtggaggaggccgtctggattacggttcactgcgc
tacttcgaggaatactggcccagcgataataccgatgccttgcaacgtatccttattcaa
tggggcaattcacagttctttccctcgatagcaatgtgttgccatgtttctgccagtccg
aatcatcagaccgggcgcactactccactgaaattccgctttgacgtagctatgcaggga
gctttgggaatggatttacaaccgtccaccatgaatgaaaaagaagtaatctttgccaaa
gaggctatcaagacttacgaaagtatccgtaacatagtgtttacaggcgacctgtaccgt
attttatctccttacgaaggtaaccgcacctccatgatgtatgtattgccggacaaaagt
cgtgccgtattctatgcttaccaattaaaatcacatatcggtgaagttagtgctccgatg
cgtttcaaaggtctgattcccgacaagaaatacaacgtgaaagaattgaacatctatccg
ggaagccgtgctgcaacagggtcagccaacggacaatctttcagtggcgatttcctgatg
aatcaaggcttgcctattggtttatccggtgattacagtagcgctgtcattgagttggaa
cagcagtag

DBGET integrated database retrieval system