KEGG   Bacteroides fragilis 638R: BF638R_0558Help
Entry
BF638R_0558       CDS       T01691                                 

Gene name
glcK
Definition
putative ROK family transcriptional repressor
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
bfg  Bacteroides fragilis 638R
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Butirosin and neomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:bfg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BF638R_0558 (glcK)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BF638R_0558 (glcK)
   00052 Galactose metabolism
    BF638R_0558 (glcK)
   00500 Starch and sucrose metabolism
    BF638R_0558 (glcK)
   00520 Amino sugar and nucleotide sugar metabolism
    BF638R_0558 (glcK)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BF638R_0558 (glcK)
   00524 Butirosin and neomycin biosynthesis
    BF638R_0558 (glcK)
Enzymes [BR:bfg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     BF638R_0558 (glcK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
648496..649476
Genome map
AA seq 326 aa AA seqDB search
MNSSMEKPYVVGIDIGGTNTVFGIVDARGTIIASGAVKTQVYPTVEEYADEVCKNLLPLI
IANGGVDKIKGIGIGAPNGNYYTGTIEFAPNLPWKGVLPLASMFEERLGIPTALTNDANA
AAVGEMTYGAARGMKDFIMITLGTGVGSGIVINGQVVYGHDGFAGELGHVIVRRDGRICG
CGRKGCLETYCSATGVARTAREFLAARTDASLLRNIPAESIVSKDVYDAAVQGDKLAQEI
FEFTGNILGEALADAIAFSSPEAIILFGGLAKSGDYIMKPIMKAMENNLLNIYKGKAKLL
VSELKDSDAAVLGASALAWELKDLRD
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgaattcaagcatggagaagccctatgtggtgggtattgacattggcggaacaaacact
gtctttggaattgttgacgcgcgcggaactattatagcaagcggtgcagtgaaaactcaa
gtatatcctacagtagaagaatatgcagatgaagtatgcaaaaatcttctgccgttgatt
atcgcaaatggcggggtggataaaataaagggtatcggcattggcgctcctaatgggaac
tattataccggaaccattgaatttgctcctaacttgccttggaaaggtgtattgccgttg
gcttctatgttcgaagaacgcttgggtataccgactgccttgacaaacgatgctaatgct
gccgcagtgggcgaaatgacttacggagctgcccgcggtatgaaagattttatcatgatt
actctgggaacaggtgtcggtagtggtatcgttatcaacggacaggtggtttacggtcat
gacggttttgcaggcgaactcggtcacgtgattgttcgtcgtgacggacgtatctgtggt
tgcggacgcaagggctgtctggaaacttactgctcggctacaggtgtggcacgcactgca
cgcgaattcctcgctgcacgtaccgatgccagcttgttgcgtaatatcccggctgagagc
attgtatcgaaagacgtatacgatgcagccgtacagggagataaactggctcaggagatt
ttcgaatttacaggtaatattctgggtgaagcattggcagacgctattgctttctcgagt
ccggaagctattatcctgttcggtggtttggcaaaatcgggtgattacattatgaagccg
attatgaaagccatggagaataaccttctgaacatttacaaaggtaaagcaaaattgctc
gtttctgagttgaaggactctgacgctgctgtgctgggtgccagtgcattggcttgggaa
ctgaaagacttgagagactaa

  All links  
No link information was found.   
DBGET integrated database retrieval system