KEGG   Bacteroides fragilis 638R: BF638R_0607Help
Entry
BF638R_0607       CDS       T01691                                 

Gene name
thrC
Definition
(RefSeq) putative threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
bfg  Bacteroides fragilis 638R
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bfg00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BF638R_0607 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BF638R_0607 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    BF638R_0607 (thrC)
Enzymes [BR:bfg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     BF638R_0607 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
723849..725150
Genome map
AA seq 433 aa AA seqDB search
MKYYSTNKQAPLASLEEAVVKGLASDKGLFMPMTIKPLPQEFYDEIENLSFREIAYRVAD
VFFGEDVPAETLKEIVYDTLNFDVPLVPVKENIYSLELFHGPTLAFKDVGGRFMARLLGY
FIRKEGRKQVNVLVATSGDTGSAVANGFLGVEGIHVYVLYPKGKVSEIQEKQFTTLGRNI
TALEVDGTFDDCQALVKAAFMDQELNEQLLLTSANSINVARFLPQAFYYFYAYAQLKKAG
RAENVVICVPSGNFGNITAGLFGKKMGLPVRRFIAANNKNDIFYQYLQTGQYNPRPSVAT
IANAMDVGDPSNFARVLDLYGGSHAAIAAEISGTTYTDEQIRESVKACWQQTGYLLDPHG
ACGYRALEEGLQPGETGVFLETAHPAKFLQTVESIIGTEVEIPAKLRAFMKGEKKSLPMT
KEFADFKSYLLGK
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgaaatattatagtactaacaaacaagctccgcttgcttcgcttgaagaagcggtagtc
aaaggacttgcttctgataaggggctattcatgcccatgaccatcaagcccttgccccaa
gagttttatgacgagatagagaatctttctttccgggaaatcgcttaccgggtggcagat
gttttctttggagaagatgttccggcagaaacgctgaaagagattgtttatgatacgttg
aattttgatgtcccattggtgccggtgaaggagaacatctattccctggagcttttccac
ggtcctacattggcttttaaagatgtaggtggacggtttatggcccgtttgttgggatac
ttcatccggaaagaggggcggaaacaggtgaatgtgctcgtagccacttccggagatacc
ggtagtgcggtagccaatggctttttgggggtagagggtattcatgtgtacgtgctctat
ccgaagggaaaagtcagcgagatacaggaaaaacagttcactacgctggggcggaatatt
acagccctggaggtggatggaacgtttgacgactgccaggcgctggtgaaagcagccttt
atggatcaggaactgaacgaacagttgttgctgacctcggctaactctatcaacgtggca
cgtttcctgccgcaggcattctattatttttatgcctatgcgcaattgaagaaggccggc
cgggcagagaatgtcgtcatctgtgtgccgagcggaaactttggtaacattactgcaggc
ttgttcggcaaaaagatgggcttgcccgtccgccgttttatcgccgccaacaataagaat
gatattttctatcaatatttgcagacaggacagtacaatccccgtccgtccgttgccacc
attgccaatgcgatggatgtgggtgatccgagcaactttgcccgtgtgctcgacctgtat
ggcggttcgcatgcagccatcgctgccgagatatccggaacgacgtacaccgacgagcag
attcgtgaaagcgtgaaagcgtgctggcagcagacgggttatctgctcgatcctcatgga
gcatgcggttaccgtgcattggaggaaggcttgcagccgggtgagacaggcgtattcctc
gaaacggcccatccggccaaattcctgcaaacggtggagagcatcattggtaccgaggtc
gaaatacctgctaagctccgggcttttatgaaaggcgaaaagaaaagtttgccgatgacg
aaggagtttgctgatttcaagagctatctgttgggcaagtag

DBGET integrated database retrieval system