KEGG   Bacteroides fragilis 638R: BF638R_0607Help
Entry
BF638R_0607       CDS       T01691                                 

Gene name
thrC
Definition
putative threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
bfg  Bacteroides fragilis 638R
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bfg00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BF638R_0607 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BF638R_0607 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    BF638R_0607 (thrC)
Enzymes [BR:bfg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     BF638R_0607 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
723849..725150
Genome map
AA seq 433 aa AA seqDB search
MKYYSTNKQAPLASLEEAVVKGLASDKGLFMPMTIKPLPQEFYDEIENLSFREIAYRVAD
VFFGEDVPAETLKEIVYDTLNFDVPLVPVKENIYSLELFHGPTLAFKDVGGRFMARLLGY
FIRKEGRKQVNVLVATSGDTGSAVANGFLGVEGIHVYVLYPKGKVSEIQEKQFTTLGRNI
TALEVDGTFDDCQALVKAAFMDQELNEQLLLTSANSINVARFLPQAFYYFYAYAQLKKAG
RAENVVICVPSGNFGNITAGLFGKKMGLPVRRFIAANNKNDIFYQYLQTGQYNPRPSVAT
IANAMDVGDPSNFARVLDLYGGSHAAIAAEISGTTYTDEQIRESVKACWQQTGYLLDPHG
ACGYRALEEGLQPGETGVFLETAHPAKFLQTVESIIGTEVEIPAKLRAFMKGEKKSLPMT
KEFADFKSYLLGK
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgaaatattatagtactaacaaacaagctccgcttgcttcgcttgaagaagcggtagtc
aaaggacttgcttctgataaggggctattcatgcccatgaccatcaagcccttgccccaa
gagttttatgacgagatagagaatctttctttccgggaaatcgcttaccgggtggcagat
gttttctttggagaagatgttccggcagaaacgctgaaagagattgtttatgatacgttg
aattttgatgtcccattggtgccggtgaaggagaacatctattccctggagcttttccac
ggtcctacattggcttttaaagatgtaggtggacggtttatggcccgtttgttgggatac
ttcatccggaaagaggggcggaaacaggtgaatgtgctcgtagccacttccggagatacc
ggtagtgcggtagccaatggctttttgggggtagagggtattcatgtgtacgtgctctat
ccgaagggaaaagtcagcgagatacaggaaaaacagttcactacgctggggcggaatatt
acagccctggaggtggatggaacgtttgacgactgccaggcgctggtgaaagcagccttt
atggatcaggaactgaacgaacagttgttgctgacctcggctaactctatcaacgtggca
cgtttcctgccgcaggcattctattatttttatgcctatgcgcaattgaagaaggccggc
cgggcagagaatgtcgtcatctgtgtgccgagcggaaactttggtaacattactgcaggc
ttgttcggcaaaaagatgggcttgcccgtccgccgttttatcgccgccaacaataagaat
gatattttctatcaatatttgcagacaggacagtacaatccccgtccgtccgttgccacc
attgccaatgcgatggatgtgggtgatccgagcaactttgcccgtgtgctcgacctgtat
ggcggttcgcatgcagccatcgctgccgagatatccggaacgacgtacaccgacgagcag
attcgtgaaagcgtgaaagcgtgctggcagcagacgggttatctgctcgatcctcatgga
gcatgcggttaccgtgcattggaggaaggcttgcagccgggtgagacaggcgtattcctc
gaaacggcccatccggccaaattcctgcaaacggtggagagcatcattggtaccgaggtc
gaaatacctgctaagctccgggcttttatgaaaggcgaaaagaaaagtttgccgatgacg
aaggagtttgctgatttcaagagctatctgttgggcaagtag

DBGET integrated database retrieval system