KEGG   Bacteroides fragilis 638R: BF638R_0781Help
Entry
BF638R_0781       CDS       T01691                                 

Definition
hypothetical protein
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
bfg  Bacteroides fragilis 638R
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Polyketide sugar unit biosynthesis [PATH:bfg00523]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:bfg00521]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
950300..950740
Genome map
AA seq 146 aa AA seqDB search
MIEGVSLHPLKQISVPNGDLWHAFKATDEGFVGFGEAYFTQVKPHAVKGWKRHNRYVLNL
VVVSGAVKFVIFDDREGSTTKGEFQEVLLTPNGNYQRLTVAPGLWMAFAGADSEQTSMLM
DLIPEVHAPSEGDRKEIDEIEYNFNV
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
atgatagaaggtgtttctttacatccgctgaagcagataagcgtgccaaatggtgacctt
tggcatgctttcaaagctacagacgaaggatttgtaggctttggtgaagcttactttact
caggtcaaacctcatgctgtcaaaggttggaagcgtcataatcggtatgtgcttaacctt
gtggtagtaagtggtgctgtcaagttcgttatctttgatgatcgtgaaggtagtacaaca
aagggcgagttccaggaggtgcttctcacaccaaatggcaactaccagcgtcttactgta
gcacctggactgtggatggcatttgcaggagcagattcagagcagacatctatgctgatg
gatttgatacctgaagtacacgccccatctgaaggcgatcgcaaggaaatagacgagatt
gagtacaacttcaacgtgtaa

DBGET integrated database retrieval system