KEGG   Bacteroides fragilis 638R: BF638R_1259Help
Entry
BF638R_1259       CDS       T01691                                 

Gene name
trpB
Definition
(GenBank) putative tryptophan synthase beta subunit
  KO
K06001  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
bfg  Bacteroides fragilis 638R
Pathway
bfg00260  Glycine, serine and threonine metabolism
bfg00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bfg01100  Metabolic pathways
bfg01110  Biosynthesis of secondary metabolites
bfg01130  Biosynthesis of antibiotics
bfg01230  Biosynthesis of amino acids
Module
bfg_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bfg00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BF638R_1259 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BF638R_1259 (trpB)
Enzymes [BR:bfg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BF638R_1259 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP IES5
Motif
Other DBs
NCBI-ProteinID: CBW21806
UniProt: E1WR38
Position
complement(1509893..1511260)
Genome map
AA seq 455 aa AA seqDB search
MSDKKKRYMLPEEEIPHYWYNIQADMVNKPMPPLHPGTKQPLKAEDLYPIFAEELCRQEL
NQTDQWIEIPEEVREMYKYYRSTPLVRAYGLEKALGTPAHIYFKNESVSPMGSHKLNSAI
PQAYYCKKEGVQNVTTETGAGQWGASLAYAAKLFGLEAAVYQVKISYEQKPYRRSIMQTY
GAQVTPSPSMSTRAGKDILTAHPNHQGSLGTAISEAIELAQTTPNCKYTLGSVLSHVTLH
QTVIGLEAEKQMAMAGEYPDMVIACFGGGSNFGGIAFPFMRHNILEGKKTRFIAAEPASC
PKLTRGKFQYDFGDEAGYTPLLPMFTLGHNFAPANIHAGGLRYHGAGVIVSQLLKDKLME
AVDISQLESFEAGCLFAQVEGIIPAPESCHAIAATIREANKCKESGEEKVILFNLSGHGL
IDMASYDKYLSGDLVNYSLTDDDIQKNLDEIGNLA
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacaagaaaaaaaggtacatgctgcctgaagaagaaattccacactattggtac
aacatacaagccgacatggtgaacaaaccgatgcctccgttgcatccgggaaccaaacag
ccattaaaggcagaagacctgtatccgatcttcgcagaagaactttgccgtcaggagctg
aaccagactgaccaatggatcgaaataccggaagaagttcgtgaaatgtataaatattac
cgtagtactccattggttcgtgcctatggtttggaaaaagcattgggtacgccggcacat
atctatttcaagaatgaaagtgtcagcccgatgggttcacacaaattaaattccgccatc
cctcaagcttattattgcaaaaaagaaggcgtacaaaacgtaacaactgaaaccggagca
ggacaatggggagcctctttggcctatgccgctaaactcttcggtctggaagcagccgtc
tatcaggtaaagatcagctatgaacagaaaccttaccgccgcagtatcatgcagacttat
ggtgcccaagtgaccccatccccttcaatgtcaacccgtgcaggaaaagatatcctgact
gcacaccccaatcatcagggatcattagggaccgccatctccgaggcaatcgaactggca
caaaccactcctaactgcaaatatacattaggttccgttttgagccatgtcacccttcac
cagacagtgatcggtctggaagccgaaaagcagatggcaatggctggcgaatatcctgat
atggtgattgcctgctttggtggcggctccaacttcggtggtatcgcattccctttcatg
cgtcacaacatacttgaaggtaaaaagacacgtttcatcgctgccgaaccggcatcttgc
ccgaaacttacccgaggcaagttccagtacgacttcggtgatgaagccggatatactcca
ctgttgcctatgttcacattaggacataactttgccccggccaatatccatgcaggcgga
cttcgttatcacggtgccggagtaatcgtttcgcaactcctgaaagacaaactgatggaa
gcagtagatatcagtcagttggaatcattcgaagcaggatgcctgttcgcacaagttgag
ggaatcatccctgctccggaatcatgtcacgccattgcagccaccatccgtgaagccaat
aagtgcaaagaaagcggagaagagaaagtaatactgttcaatctgtccggccacggactg
atcgatatggcttcatatgacaaatatctgtccggcgacttggtaaactattcgcttaca
gacgatgatatccaaaagaatctggacgaaataggaaacttagcttaa

DBGET integrated database retrieval system