KEGG   Bacteroides fragilis 638R: BF638R_1259Help
Entry
BF638R_1259       CDS       T01691                                 

Gene name
trpB
Definition
(GenBank) putative tryptophan synthase beta subunit (EC:4.2.1.20)
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
bfg  Bacteroides fragilis 638R
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bfg00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BF638R_1259 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BF638R_1259 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BF638R_1259 (trpB)
Enzymes [BR:bfg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BF638R_1259 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1509893..1511260)
Genome map
AA seq 455 aa AA seqDB search
MSDKKKRYMLPEEEIPHYWYNIQADMVNKPMPPLHPGTKQPLKAEDLYPIFAEELCRQEL
NQTDQWIEIPEEVREMYKYYRSTPLVRAYGLEKALGTPAHIYFKNESVSPMGSHKLNSAI
PQAYYCKKEGVQNVTTETGAGQWGASLAYAAKLFGLEAAVYQVKISYEQKPYRRSIMQTY
GAQVTPSPSMSTRAGKDILTAHPNHQGSLGTAISEAIELAQTTPNCKYTLGSVLSHVTLH
QTVIGLEAEKQMAMAGEYPDMVIACFGGGSNFGGIAFPFMRHNILEGKKTRFIAAEPASC
PKLTRGKFQYDFGDEAGYTPLLPMFTLGHNFAPANIHAGGLRYHGAGVIVSQLLKDKLME
AVDISQLESFEAGCLFAQVEGIIPAPESCHAIAATIREANKCKESGEEKVILFNLSGHGL
IDMASYDKYLSGDLVNYSLTDDDIQKNLDEIGNLA
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacaagaaaaaaaggtacatgctgcctgaagaagaaattccacactattggtac
aacatacaagccgacatggtgaacaaaccgatgcctccgttgcatccgggaaccaaacag
ccattaaaggcagaagacctgtatccgatcttcgcagaagaactttgccgtcaggagctg
aaccagactgaccaatggatcgaaataccggaagaagttcgtgaaatgtataaatattac
cgtagtactccattggttcgtgcctatggtttggaaaaagcattgggtacgccggcacat
atctatttcaagaatgaaagtgtcagcccgatgggttcacacaaattaaattccgccatc
cctcaagcttattattgcaaaaaagaaggcgtacaaaacgtaacaactgaaaccggagca
ggacaatggggagcctctttggcctatgccgctaaactcttcggtctggaagcagccgtc
tatcaggtaaagatcagctatgaacagaaaccttaccgccgcagtatcatgcagacttat
ggtgcccaagtgaccccatccccttcaatgtcaacccgtgcaggaaaagatatcctgact
gcacaccccaatcatcagggatcattagggaccgccatctccgaggcaatcgaactggca
caaaccactcctaactgcaaatatacattaggttccgttttgagccatgtcacccttcac
cagacagtgatcggtctggaagccgaaaagcagatggcaatggctggcgaatatcctgat
atggtgattgcctgctttggtggcggctccaacttcggtggtatcgcattccctttcatg
cgtcacaacatacttgaaggtaaaaagacacgtttcatcgctgccgaaccggcatcttgc
ccgaaacttacccgaggcaagttccagtacgacttcggtgatgaagccggatatactcca
ctgttgcctatgttcacattaggacataactttgccccggccaatatccatgcaggcgga
cttcgttatcacggtgccggagtaatcgtttcgcaactcctgaaagacaaactgatggaa
gcagtagatatcagtcagttggaatcattcgaagcaggatgcctgttcgcacaagttgag
ggaatcatccctgctccggaatcatgtcacgccattgcagccaccatccgtgaagccaat
aagtgcaaagaaagcggagaagagaaagtaatactgttcaatctgtccggccacggactg
atcgatatggcttcatatgacaaatatctgtccggcgacttggtaaactattcgcttaca
gacgatgatatccaaaagaatctggacgaaataggaaacttagcttaa

DBGET integrated database retrieval system