KEGG   Bacteroides fragilis 638R: BF638R_1665Help
Entry
BF638R_1665       CDS       T01691                                 

Definition
putative aldose 1-epimerase precursor
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
bfg  Bacteroides fragilis 638R
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bfg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BF638R_1665
   00052 Galactose metabolism
    BF638R_1665
Enzymes [BR:bfg01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     BF638R_1665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1942827..1943951)
Genome map
AA seq 374 aa AA seqDB search
MQEILIIPDMINTFPTEGNRSGLSRKDFQKDINDKKTDLFILKNKKGMEVAVTNYGCAIL
SIMVPDKDGKYANVVLSYGTLDALMHGPEPFLSTTIGRYGNRIAKGKFTLYGEEHSLTIN
NGPNSLHGGPTGFHARVWDAEQLEEGVIRFNYTSADGEEGFPGNLEVEMTYRLEEEENAI
VIEYRATTDKATVVNLTNHGFFNLAGTANPTPTVENNIVTINADFYTPIDEVSIPTGEIA
KVEGTPMDFRTPHTVGERINDKFQQLIYGAGYDHCYVLNKAETGSLDLAATCKEPNSGRT
MEVYTTEAGVQLYTGNWLGGFEGTNGATFPARSAICFEAQCFPDTPNKAHFPSATLLPGD
EYQQVTIYKFGVEK
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
ttgcaagaaattttaataataccagacatgattaacacattcccaactgaaggaaatcgg
tcagggctcagccggaaagattttcaaaaggatataaacgataagaaaaccgatttgttt
atcctcaaaaacaagaaaggaatggaagttgccgtaacaaactacggatgcgccattcta
tctatcatggttccggataaagacggaaaatatgccaatgtcgtactcagctatggtaca
ctggatgcactgatgcacggaccggaacctttcttaagtaccactatcggacgttatggc
aatcgcatcgccaaaggtaaattcaccctgtatggcgaagaacatagtctcacgatcaac
aacggtcccaactcacttcatggtggccccaccggatttcacgccagagtatgggatgcc
gagcaacttgaagaaggggtgatccgattcaactatacttccgctgacggagaagagggc
ttccccggtaatctggaagttgaaatgacttatcgccttgaagaagaagagaatgctatt
gtcatcgaataccgtgccactacagacaaagcaacagtcgtaaacctgaccaatcacggt
ttcttcaacctggcaggaacagccaatcctactccgactgtagaaaataacatcgtcaca
atcaacgcagatttttatactccgatcgatgaagtatccatcccgacaggagaaatagcc
aaagtggaaggaactccgatggatttccgtaccccacatactgttggcgaacgaatcaat
gacaaattccagcaacttatatacggtgccggctatgaccattgctatgtattgaacaag
gcagaaacaggttctctcgacctggcagctacctgcaaagagcccaacagcggacgcacc
atggaggtatataccacagaagccggcgtacaattatacacaggcaactggctgggcggc
ttcgaaggaacaaacggagctactttccccgcacgaagcgctatctgcttcgaagctcaa
tgtttccccgacacaccgaataaagcacacttcccgtcagctactttactgccgggcgat
gaataccagcaggtaaccatctataaattcggagttgaaaaataa

DBGET integrated database retrieval system