KEGG   Bacteroides fragilis 638R: BF638R_1733Help
Entry
BF638R_1733       CDS       T01691                                 

Gene name
nahB
Definition
beta-N-acetylhexosaminidase
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
bfg  Bacteroides fragilis 638R
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bfg00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    BF638R_1733 (nahB)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    BF638R_1733 (nahB)
Enzymes [BR:bfg01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     BF638R_1733 (nahB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2036265..2038589
Genome map
AA seq 774 aa AA seqDB search
MRNLFKIAGLLALTGFISSCNDKETTANYQVIPLPQEITTAQSQPFTLNGSVKIIYPEGN
EKMQRNAQFLADYLKKATGKDYAVEAGTEGKGAILLKLGMESENPEAYQLSVNADGVTIA
APTEAGVFYGIQTLRKSIPVAIGTTPSLPAVEISDYPRFSYRGAHFDVGRHFFTVDEVKT
YIDMMALHNMNRLHWHLTEDQGWRLEIKKYPKLTEIGSKRSETVIGRNSGEYDGKPYGGF
YTQEEAREIVAYAADRYITVIPEIDLPGHMQGALAAYPHLGCTGGPYEVWKIWGVSDQVL
CAGNDSVLTFIDDVLTEVMDIFPSEYIHVGGDECPKTEWAKCPKCQARIKALGIKSDAKH
SKEEYLQSFVINHAEKFLNEHGRQIIGWDEILEGGLAPNATVMSWRGEGGGIEAAKQKHD
VIMTPNTYLYFDYYQTKDTENEPLAIGGYLPLERVYGYEPMPSSLTPEEQKYIIGVQANL
WTEYIPTFSQAQYMVLPRWAALAEVQWSNPEKKNYENFLSRLPQLINIYDAEGYNYAKHV
FDVKSEFVANSATGAVDVVMTTIDGAPIHYTLDGTEPTAASPVCDSILTIKESCTLKAVA
VRPTGNSKMLTEQIAFSKSTSKPIKANQPVNKQYEFGGVSTLVDGLKGNGNYKTGRWIAF
YKNDMDVTIDLQQPTEISSVAITTCVEKGDWVFDARSFSIEVSDDDKTFTKVASEAYPEM
KETDRNGLYEHKLTFDPVKTRYVKVIATSEHSIPAWHGGKGNPGFLFVDEITLN
NT seq 2325 nt NT seq  +upstreamnt  +downstreamnt
atgagaaatctttttaaaattgccggtttactggcgctcacgggatttatttcttcgtgt
aacgacaaagaaactacagctaattaccaggtaattcctttacctcaggaaattacgact
gctcaaagccaaccatttacattaaatggtagtgtaaaaatcatctatccggaaggaaat
gaaaagatgcaacgcaatgcccaattcctggctgattatctgaagaaagccacaggtaag
gattatgccgttgaagcaggtactgagggcaaaggtgctattctgcttaagttgggtatg
gaatcagaaaaccccgaagcttatcagttgagtgtgaacgcagatggtgtaactattgct
gctcctactgaagctggtgtattctatggtatccagactttacgtaagtctattccggta
gctatcggtacaactccttcattgccggctgtcgagattagcgactatcctcgttttagt
tatcgtggtgcccattttgatgtaggtcgccatttcttcacagtagacgaagtaaagaca
tacatcgatatgatggctttgcataacatgaaccgtttacactggcacttaaccgaagat
cagggatggagacttgaaatcaagaagtatcctaaactgactgagatcggttcaaaaaga
tcggaaactgtaatcggacgtaattccggtgaatatgacggaaaaccttacggtggtttc
tatactcaggaagaagccagagaaatcgtagcgtatgctgcagatcgttatatcactgtt
attcctgaaatcgaccttccgggacatatgcagggagcattggccgcttatccgcatttg
ggatgtacaggtggaccgtatgaggtttggaaaatatggggagtatctgatcaggtgctt
tgtgccggaaacgacagtgtactgacttttattgatgatgtcttgacggaagtaatggat
atcttcccttctgaatatattcatgtcggaggtgacgaatgtccgaagactgaatgggcg
aaatgtccgaagtgccaggctcgtatcaaggccttgggaatcaagagtgacgctaaacat
tcaaaagaagagtatttgcagagttttgttatcaatcatgcagaaaaattcctgaacgaa
catggacgtcagattattggctgggatgaaatcctggaaggtggactggctccgaatgct
acagtgatgtcatggcgcggcgaaggtggcggtatcgaagctgccaagcagaaacatgat
gttatcatgaccccgaacacttatctttactttgactactatcagaccaaggatacagag
aatgaacctttggctatcggtggttatttacctttggagagagtgtatggttacgagccg
atgccttcttcattgactccggaagagcaaaaatatattattggtgtacaagctaatctt
tggacggaatacattcctactttctctcaggctcagtatatggtgttgccgcgttgggct
gctttagcagaggtgcaatggtctaatcctgaaaagaagaattatgaaaacttcctgagc
cgtttgccgcagttgattaatatttatgatgctgaaggatataattatgccaaacatgta
tttgatgtgaaatctgagtttgtagctaattcggccacaggagcagtagacgtagtgatg
actactattgacggtgctcccattcattatacattagatggaactgagcctacggcagct
tctcctgtgtgtgatagtattcttacaatcaaggaaagttgtactctgaaagcggttgct
gtccgtcctaccggaaacagcaaaatgctgactgaacagattgctttcagtaaatctact
tcaaaacctattaaagccaatcagcctgtaaacaagcaatatgaatttggtggtgtttct
acattagtagacggactgaaaggaaatggcaattataaaacaggtcgttggatcgctttt
tataaaaatgatatggatgtaacgattgacttgcaacaacctaccgagatctccagtgta
gctatcactacttgtgttgaaaagggcgactgggtatttgatgcacgttctttctcaatt
gaagtatcagatgacgataagacttttacaaaggtagcttctgaagcatatcctgaaatg
aaagagacagatcgtaatggcctttacgagcacaaattgacttttgatccggtaaaaacc
cgttatgtgaaagtgattgcaacatcggaacactcgattccggcatggcatggtggtaaa
ggtaatccgggcttcttatttgtagatgaaattacgttgaattga

DBGET integrated database retrieval system