KEGG   Bacteroides fragilis 638R: BF638R_1750Help
Entry
BF638R_1750       CDS       T01691                                 

Definition
putative transcriptional repressor
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
bfg  Bacteroides fragilis 638R
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Butirosin and neomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:bfg01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:bfg00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:bfg00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:bfg00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:bfg00520]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:bfg00521]
Metabolism; Biosynthesis of other secondary metabolites; Butirosin and neomycin biosynthesis [PATH:bfg00524]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2060956..2061813
Genome map
AA seq 285 aa AA seqDB search
MKLSIDLGGTNVRIAQVENGICLNKMSVPCLAQQDASAVLDQLFQLITGMMNVQVDGIGI
GVPSIVDVEKGIVYNVANISSWKKIHLKDILEKRFMVPVAINNDSNCFTLGESMFGEGKP
YAHMVGVTIGTGIGAGVIINHRLYCGQYMGAGEIGSLPYLDSDFEHYCSSSFFKRHDTTG
VVVAEKAERGDGAALEIWREFGTHLGNLMKVILFSYAPQAIILGGSIVSAFHFFKDTMKD
AMQDFPYKILLDNVKIITSYLKDASLLGASALFEKQYLPISIINN
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgtcaattgatttaggaggaacaaatgttcgaattgcccaagtggagaatggt
atctgtttgaacaagatgtctgtaccttgtcttgcgcaacaagatgcttcagcggtactt
gatcagctttttcaacttattacgggtatgatgaacgtccaggtggatggtattggtatc
ggtgtcccttcaattgtagatgtggaaaaaggtatcgtgtataatgtggcgaatatatct
tcttggaaaaaaatacatttgaaagatatattggaaaagcgatttatggtgccggttgct
attaacaatgactctaattgtttcactttaggcgaaagtatgttcggcgaggggaagcct
tatgcccatatggtgggagttactattgggacaggtataggtgcgggtgttatcattaat
catcggttgtattgtggtcaatatatgggggccggtgaaataggctcgcttccttatctg
gattctgattttgaacattattgcagtagttctttctttaagcgacatgacacgacaggt
gtagtggtagccgaaaaagcagaacggggagatggggctgcgctggaaatctggagggaa
tttgggacgcatctgggtaatttgatgaaagtaattctcttttcttatgctcctcaagct
attattttgggcggaagtatagtatcggcttttcacttttttaaggatactatgaaggac
gctatgcaagatttcccttataaaatactattggacaatgtgaaaataattacttcatat
ttgaaggatgctagcttattaggagcttccgctttgtttgagaaacaatatttaccaata
tctattataaacaattaa

DBGET integrated database retrieval system