KEGG   Bacteroides fragilis 638R: BF638R_1755Help
Entry
BF638R_1755       CDS       T01691                                 

Definition
putative Alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
bfg  Bacteroides fragilis 638R
Pathway
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bfg00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BF638R_1755
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    BF638R_1755
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BF638R_1755
Enzymes [BR:bfg01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     BF638R_1755
Exosome [BR:bfg04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BF638R_1755
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2070622..2071773
Genome map
AA seq 383 aa AA seqDB search
MITMKNILRNFVFIVWAVALLPVNVSAQNRRDKEQTYVLEQPYEVTKITPSQGKKIKNVI
LMIGDGMSLMHVYSAWTANRGKLFLDNCQAVGLSKTYCADKLITDSGAGGTAIATGQKTN
YHYVGVDTLGHPLKSLVDFAAAKGKSTGIAVTCRLWDATPADFCCHNKDRDAESEIVTDY
VNCNADYVFGGGAKLFENREDGRDLFKELREKGFRTPRSWDELAGIKSGKVFAVPYPVDT
PLPAERGDLLARASLKGIDLLNQNKNGFFMMIEGSQLDDYGHFNDLDLLMQETHDFDRTI
GAIYEWAAKDGETLVVVTADHETGGLTLVDGDLKEGKIVCKFSTGGHSGVMVPVYAFGPG
AQEFTGIYENTAIFDKIKKLLDL
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgataacaatgaaaaatatattgagaaacttcgtattcatagtttgggcagttgcatta
ttgcccgtcaatgtgtcggcgcaaaatcgtagagacaaggagcaaacgtatgtattggaa
caaccgtatgaagtaaccaagataactccttctcaaggaaagaagataaaaaatgttatt
ctgatgatcggagacggcatgagtcttatgcatgtatattctgcatggacagccaaccgt
ggtaaactcttcttagacaactgtcaggctgtaggtttgtcgaaaacttactgtgcagat
aaactgattactgattcaggagcgggggggacagctattgctaccggacagaaaacaaac
tatcactatgtaggtgtagatactttgggacatcctttgaaatcattggttgattttgct
gctgccaaaggcaaatctacgggaattgcagtaacctgccgtctttgggatgctactcct
gctgatttctgttgccataataaagaccgcgatgctgagagtgagattgtgacagattat
gtgaattgtaatgcggactatgtatttggtggtggtgccaaactctttgaaaatcgcgag
gatggacgtgatctgttcaaggagttacgtgaaaaaggtttccggactccccgtagttgg
gatgaattggcaggtataaagagcggtaaagtattcgcagttccttatccggtagacacc
ccgcttcctgctgaacgtggtgacctccttgcacgtgcttcattgaaaggaattgatttg
ctgaatcagaataaaaatggtttctttatgatgattgaaggttctcaattggatgattac
gggcattttaatgatcttgatctactgatgcaggagacacatgactttgaccgcactatc
ggcgctatttatgagtgggcagccaaggatggtgaaacactggttgttgttactgcagac
catgaaactggtggccttacattagtagatggtgatttaaaggagggtaaaatcgtatgt
aaattctctacaggcgggcatagtggtgtgatggtgccggtatatgcttttggccccgga
gcacaggaatttaccggaatttatgagaatactgctatctttgacaagataaagaaatta
cttgatctttaa

DBGET integrated database retrieval system