KEGG   Bacteroides fragilis 638R: BF638R_1853Help
Entry
BF638R_1853       CDS       T01691                                 

Definition
hypothetical protein
Orthology
K04041  
fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
bfg  Bacteroides fragilis 638R
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Gluconeogenesis, oxaloacetate => fructose-6P
Class
Metabolism; Overview; Carbon metabolism [PATH:bfg01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:bfg00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:bfg00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:bfg00051]
Metabolism; Energy metabolism; Methane metabolism [PATH:bfg00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2192072..2194066
Genome map
AA seq 664 aa AA seqDB search
MTAQSNITPESIVADLRYLQLLSRSFPTIAAASTEIINLEAILNLPKGTEHFLTDIHGEY
EAFQHVLKNASGAVKRKVNEIFGHTLREIEKKELCTLIYYPEEKLQLIKATETDIDDWYL
ITLNQLVKVCQNVSSKYTRSKVRKSLPAEFSYIIQELLHESTIEPNKHAYINVIISTIIS
TRRADDFIIAMCNLIQRLTIDSLHIVGDIYDRGPGAHIIMDTLCDYHNFDIQWGNHDILW
MGAASGNEACMANVIRLSMRYGNLGTLEDGYGINLLPLATFAMDTYADDPCTIFAPKTNF
ADSTYNEKTLRLITQMHKAITIIQFKLEANIINRRPEFGMGGRKLLEKIDFERGVFVYEG
KEYPLRDTNFPTVDPADPYRLTDEEQELIEKIHYSFMNSEKLKKHMRCLFTYGGMYLVCN
SNLLYHASVPLNEDGSFKHVNICGKEYWGKNLLDKIDQLIRTAYFDEDDEEEKRFAMDYI
WYLWCGPDAPSFDKDKMATFERYFIADKSLHKETKGYYYALRNKEEICDRILEEFGVTGQ
HTHIINGHVPVKTIKGEQPMKAGGKLLVIDGGFSKAYQPETGIAGYTLVYHSHGLQLVQH
DPFQSTQKAIEEGQDIKSTTFVIEFNSQRMMVKDTDKGKELVTQILDLKKLLVAYRIGLI
KEKV
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
atgactgctcaaagtaatataacccccgaaagtatcgttgccgatctgcgttatctgcaa
ctgctttcacgtagtttccctaccattgccgctgccagtacagagattatcaatcttgaa
gccatcctgaatcttccgaaagggaccgaacactttctgaccgatatacatggcgagtat
gaagcttttcagcatgtattgaaaaatgcttcgggagcggtgaagcggaaagtgaacgaa
atattcggccatactctccgtgagatcgagaagaaagaactctgtacgcttatttattat
ccggaagagaaactccaattgattaaagcaaccgaaaccgatatcgacgattggtacctg
atcactctcaatcagctggtaaaggtctgccagaacgtatcatccaaatatacccgttcg
aaggttcgcaaatcattgccggccgagttctcctatatcatccaggagttacttcacgaa
tcgaccatcgagcccaataaacatgcttatatcaatgtgattatcagtaccattatttcc
actcgccgcgctgacgactttatcattgccatgtgtaatctgatacagcgtcttacgatc
gattcactccatatcgtgggcgatatctacgatcgtggtccgggtgcccatatcataatg
gatactttgtgtgattatcacaatttcgatatccaatggggaaatcacgatatcctctgg
atgggtgcagcatcgggtaatgaagcttgtatggccaacgtgatccgtctctcgatgcgt
tacggcaatctggggacattggaagatgggtatggcatcaatcttttgcctcttgccact
tttgcgatggatacttatgcggatgatccctgtaccatctttgcacctaagaccaacttt
gccgattctacttataacgagaagaccttgaggctgataacccagatgcataaagctatt
accatcattcagtttaagctggaggcaaacattattaatcgtcgtccggagttcggaatg
ggtggtcgcaagttgcttgagaaaatcgactttgaacggggagtatttgtctatgaaggc
aaagaatatccgttgcgcgataccaacttccctacggtagatcctgcagatccttatcgt
ctgactgatgaagagcaggaattgatagaaaagatacattactcgtttatgaacagcgag
aaactcaaaaaacacatgcgttgcctctttacctatggaggtatgtatctggtgtgcaat
tccaatttgctttatcatgcctctgtgcctctcaacgaggatggaagtttcaagcacgtg
aatatctgcggtaaagagtattgggggaagaacttgctggacaagatagaccaattgatt
cgtacggcttattttgatgaagatgatgaagaagagaaacgctttgccatggattacatc
tggtatctgtggtgcggaccggatgccccttcgttcgacaaagacaagatggctacgttc
gaacgttatttcattgcggataagagcctgcataaagagacgaaaggatattattatgct
ttgcgtaacaaagaagaaatctgtgaccggattcttgaagaattcggagtgacagggcag
catactcatatcatcaacggtcatgtgccggtaaagaccattaaaggagagcagccgatg
aaagccggtggaaaattgttggtcatcgacggtggtttttcgaaagcttatcagccggag
accggtattgccggatatacgctggtatatcattcacatggtttgcagttggtgcagcat
gaccctttccagtctacacagaaagccatcgaagagggacaggacattaagtcgactacc
ttcgtcatcgagttcaattcacaacgaatgatggtgaaagataccgataagggaaaagag
ctcgtaacgcaaattctggatttaaagaagttgttggtagcataccggatcggtttgata
aaggagaaggtctga

DBGET integrated database retrieval system