KEGG   Bacteroides fragilis 638R: BF638R_1952Help
Entry
BF638R_1952       CDS       T01691                                 

Definition
putative protoporphyrinogen oxidase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
bfg  Bacteroides fragilis 638R
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:bfg00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2299654..2301042)
Genome map
AA seq 462 aa AA seqDB search
MNQTVTENHRLRDTIIIGAGLTGLTTAYCLTRKGCDIEVIEQSPCVGGQIRTYHENGFTF
ESGPNTGVISHPEVAELLAELSPTCRLETAREASRQRLIWKGDRFHPLPSGLFSAITTPL
FSTKDKFNILGEPFRSKGNNPDETIGELVQRRLGISYLHYAVDPFISGVYAGDPMRLVTR
HALPKLYQLEQTYGSFILGGIAKSFSHRSERDRLATRKVFSTYGGLSNLTKALEQAIGIK
RFSLGAISTSLMPCEQGWVVSFTDSCGIVNRIHCRKVITTAPAFALPSLLPFVPDKQMNR
ISNLTYAPVMQVSVGLRNTYGKEFHAFGGLVPSCEQKPVLGILFPSACFDNRSPEGGALY
SYFLGGTRHPELLEKSDDEIIRLITTGLNEMLDYPAGIVPDLIRIFRHKKAIPQYESSSA
DRFAAINELQKQYPGLVVAGNLKGGIGMADRIKQAFEIARER
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgaaccagacagtaacagaaaatcatcgtttgcgagataccatcatcatcggtgcaggt
ctaacaggtctgactaccgcctattgccttacccgtaagggatgtgatatcgaggtaatt
gaacagagcccctgcgtaggcggccagatacgtacctaccacgaaaatggttttacgttt
gaaagtgggcccaataccggtgtaatctcccaccctgaagtagccgaactcttggcggaa
ctatcccccacctgccgtttagaaacggcccgtgaagcgtccaggcaacgccttatatgg
aaaggagatcgctttcatcctctcccctcaggactgttcagtgcaatcaccaccccatta
ttcagtacaaaagataaattcaatatactgggtgaacccttccgttcaaaaggaaacaat
cccgatgaaacgattggtgaactggtacagcggcgcctgggtatctcttatctacattat
gcagtagacccattcatttccggggtttatgccggtgaccctatgcgattggttacccgt
catgccctgcctaaactttatcaactagaacaaacttatggcagtttcattctcggtggt
attgcaaaatcattttcacatcgaagtgaacgcgaccggttggctacacgaaaagttttc
tctacttatgggggacttagtaacctgacaaaagcattggaacaggccattggaatcaaa
cgattctccctgggagctatttccacttccctaatgccatgtgaacaaggatgggtagtt
tctttcacagattcctgtggaatagttaaccgaatccactgccgaaaggtgataaccacc
gcacctgcctttgccctcccttcacttcttcctttcgtccctgacaagcagatgaatcgg
ataagtaatcttacctatgcccctgtgatgcaagtctccgtgggattgcgtaatacttat
ggaaaagagtttcatgcctttggcggattggttccttcctgtgaacaaaaaccagtttta
ggtattctgtttccatcggcctgtttcgataaccgttcccccgaaggaggtgcattatat
tcatacttcttaggcgggacgagacaccctgaacttctagagaaaagtgacgacgaaatt
atcaggttgataaccaccggcctgaatgaaatgttagattatcctgccggaatagtacct
gatcttatacgtatcttccggcataagaaagccatcccccaatacgaaagcagcagtgcc
gacagatttgctgcgatcaatgaactgcaaaaacagtatcccggattggtggtagcagga
aatctcaaaggaggaatcggcatggccgaccgcatcaaacaggcttttgaaatcgcccga
gaaagatga

DBGET integrated database retrieval system