KEGG   Bacteroides fragilis 638R: BF638R_2176Help
Entry
BF638R_2176       CDS       T01691                                 

Gene name
recR
Definition
putative RecR-family recombination protein
Orthology
K06187  
recombination protein RecR
Organism
bfg  Bacteroides fragilis 638R
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bfg00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BF638R_2176 (recR)
DNA repair and recombination proteins [BR:bfg03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      BF638R_2176 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2547155..2547772
Genome map
AA seq 205 aa AA seqDB search
MNQQYPSTLLEKAVGEFSKLPGIGRKTAMRLVLHLLRQDTSVVEAFGSSIITLKHEVKYC
KVCHNISDTETCQICANPQRDASMVCVVENIRDVMAVEATQQYRGLYHVLGGVISPMDGV
GPGDLQIESLVRRVAEGGINEVILALSTTMEGDTTNFYIYRKLEKMGVKLSVLARGVSIG
DELEYTDEITLGRSIVNRTTFTGTV
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaacaatatccatcgacgttacttgaaaaggccgtcggagagttttctaaattg
ccgggtatcggacggaaaacagctatgagactggtgcttcacctgttgcgtcaggatacc
tctgtggtggaagctttcggaagttctattataactttaaagcatgaggtgaaatattgc
aaggtgtgtcataatatatctgatacggaaacttgtcagatttgtgcaaatccgcagcgg
gacgcgtctatggtctgcgtagtggagaatatacgggatgtgatggccgtagaggccact
caacaatatcgtgggttgtaccatgttttggggggggtgatttcaccgatggatggggta
ggaccgggcgatctgcagatagaaagtctggtgcgccgggtagccgaagggggaataaat
gaagtgattcttgctctaagcacaaccatggaaggggataccacgaatttttatatttac
cgtaaacttgagaaaatgggtgtcaaattgagcgtacttgcccgtggggtatccattggt
gacgagctggaatacacagacgagataacgttgggtagaagtattgtgaaccgtacgact
tttaccggaaccgtttaa

DBGET integrated database retrieval system