KEGG   Bacteroides fragilis 638R: BF638R_2337Help
Entry
BF638R_2337       CDS       T01691                                 

Definition
putative folic acid related biosynthesis protein (fragment)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
bfg  Bacteroides fragilis 638R
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:bfg00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2739959..2740327
Genome map
AA seq 122 aa AA seqDB search
MHSCLICIGSNYNRKENLLLARRRLTALFPSIRFTGEQETRPLFFRNPALFSNQMARFYT
DADAERVVKELKTIEREAGREQEDKKKEKVCLDIDLLVFDDRILRPEDLQREYVRKGLEE
LK
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atgcactcctgtctgatttgtataggaagcaattataaccggaaggagaatctccttctg
gctcgcaggagactgacggctctgttcccctctatccgttttacgggtgagcaggagaca
aggccgttattctttcgtaacccggcactattctctaaccaaatggcccgtttctatacc
gatgcagatgctgaacgggtagtgaaggagttgaaaacaatcgaaagagaggccggcagg
gagcaggaagataaaaagaaagaaaaggtatgcctggatattgatctgcttgtttttgat
gaccggatcttgaggccggaagatctgcaaagagaatatgttcgcaaaggacttgaagaa
ttgaagtag

DBGET integrated database retrieval system