KEGG   Bacteroides fragilis 638R: BF638R_2348Help
Entry
BF638R_2348       CDS       T01691                                 

Definition
putative hydrolase
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
bfg  Bacteroides fragilis 638R
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bfg00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BF638R_2348
Enzymes [BR:bfg01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     BF638R_2348
Exosome [BR:bfg04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BF638R_2348
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2755423..2757435
Genome map
AA seq 670 aa AA seqDB search
MEKTLNLIKNDPWLEPYKDAIVGRFEHAMDKKAELTNGGKSTLSDFASGYLYFGLHRTDK
GWIFREWAPNASHIYMVGTFSNWEEKPAYKLKRLKNGSWEIKLPIDAIQHGDLYKLHVYW
EGGQGERIPAWANRVVQDDNTKIFSAQVWAPEKPFKFKKKTFKPSTDPLLIYECHIGMAQ
QEEKVGTYNEFREKILPRIAKEGYNCIQIMAIQEHPYYGSFGYHVSSFFAASSRFGTPEE
LKQLIDTAHGLGIAVIMDIVHSHAVKNEVEGLGNFAGDPNQYFYPGGRREHPAWDSLCFD
YGKNEVMHFLLSNCKYWLEEYHFDGFRFDGVTSMLYYSHGLGEAFCNYGDYFNGHQDDNA
ICYLTLANELIHEVNPKAITIAEEVSGMPGLAAKVEDGGYGFDYRMAMNIPDYWIKTIKE
KIDEDWKPSSMFWEVTNRRQDEKTISYAESHDQALVGDKTIIFRLIDADMYWHMQKGDEN
YIVHRGVALHKMIRLLTASTINGGYLNFMGNEFGHPEWIDFPREGNGWSCKYARRQWDLV
DNKNLTYHYLGDFDADMLKVIKSVKNIQQTPVQEIWHNDGDQVLAYQRKDLVFVFNFNPS
QSFTDYGFLVTPGTYEVVLNTDNIIYGGNGLSDDSVKHFTLSDPLYKKEKKEWLKLYIPA
RTAMVLRRTK
NT seq 2013 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagactcttaatcttattaaaaatgatccttggctggaaccttacaaagacgct
atcgttggacgttttgaacatgccatggataagaaggccgaattgaccaatgggggaaaa
tctacgttatcggacttcgcttccggatatctttatttcggtttgcatcgcactgataaa
ggatggatattccgtgagtgggcaccgaatgcatcacatatttatatggtgggtacattc
agtaattgggaagaaaagcctgcttataaactaaaacgcctgaaaaatggtagttgggaa
atcaaattaccgatcgacgctatacaacatggtgacttatataaattacacgtctactgg
gaaggcggacagggagaacgaatccctgcttgggccaatcgggtagtacaagatgacaat
acaaaaatattcagtgctcaggtatgggcaccggaaaagccatttaaatttaaaaagaaa
acttttaagcctagtacagatccactgctaatctatgaatgtcatatcggtatggcacag
caggaagaaaaagtcggaacttataacgagtttcgtgaaaaaattctgccgcgtattgcc
aaagagggatataattgcattcagattatggctatacaggagcacccatattatggtagt
tttggctatcatgtatcgagtttttttgctgcatcgtctcgttttggaactccagaagaa
cttaagcagctgattgataccgcacacggattgggtattgctgtcattatggatatcgtt
cactcacatgcagtgaagaatgaagtagaagggttaggaaactttgcaggtgatccaaat
caatatttctatccaggcggacgaagagaacatccggcatgggattcactttgttttgac
tatggtaaaaatgaagtgatgcattttttactttccaattgtaaatattggttggaagaa
tatcattttgatggcttccgttttgacggggtgacatccatgctttattatagccacgga
ttgggagaagcattttgcaattacggcgactactttaatggacatcaagatgataatgcc
atctgctatctgacattggcaaacgaattgattcatgaagtaaatcctaaggctattacc
attgcagaagaggtttcgggtatgccaggacttgccgccaaggtggaagatggaggatat
ggatttgattatcgtatggctatgaatatccccgattattggatcaagacaattaaagag
aagatagatgaagattggaaaccatccagcatgttttgggaagtaactaaccgtcggcaa
gacgaaaaaacaatttcgtacgctgaaagtcatgatcaggcattggtaggagataaaacg
attattttccgcctgattgatgcagatatgtattggcatatgcagaaaggtgatgaaaat
tatatagttcatcggggcgttgctcttcacaaaatgattcgtttactaactgcaagcacc
attaacggtggatatctgaactttatgggaaatgaattcggacatccggaatggatcgat
tttccgagggaaggtaatggatggtcatgtaagtatgctcgccgccaatgggatttagtc
gataataaaaacttgacttatcattatctgggtgattttgatgcagatatgttgaaagta
attaagagcgtaaaaaacatccagcaaacccctgtacaagaaatatggcacaacgatggc
gaccaagtgttagcgtaccaacgtaaagatcttgtttttgtattcaattttaatccgagt
caatcattcaccgattatggctttttagtaacaccgggaacttatgaggtggtactgaat
acagataacataatttatggaggaaatggcttgtcagatgatagtgtgaaacatttcaca
ttgtctgatcctttgtataagaaagaaaagaaagaatggttgaaactctatattcctgca
cgtacagcaatggtattgagaagaaccaaataa

DBGET integrated database retrieval system