KEGG   Bacteroides fragilis 638R: BF638R_2361Help
Entry
BF638R_2361       CDS       T01691                                 

Gene name
sucC
Definition
(RefSeq) succinyl-CoA synthetase beta chain
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
bfg  Bacteroides fragilis 638R
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bfg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BF638R_2361 (sucC)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BF638R_2361 (sucC)
   00640 Propanoate metabolism
    BF638R_2361 (sucC)
   00660 C5-Branched dibasic acid metabolism
    BF638R_2361 (sucC)
Enzymes [BR:bfg01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     BF638R_2361 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2768634..2769782)
Genome map
AA seq 382 aa AA seqDB search
MKVHEYQAKEIFSTYGIPVERHALCHTADGAVAAYHRMGVNRVAIKAQVLTGGRGKAGGV
KLANNDRDVYQYAQTILEMTIKGYPVTKILLSEAVNIAAEYYISFTIDRNTRSVTLIMSA
AGGMDIEEVARQSPEKIIRCSIDPLIGVPDYLAHKFAFSLFEQAEQANRMATIIQDLYKA
FIEKDASLAEINPLVLTPVGTLLAIDAKMVFDDNALYRHPDLQKLSEPTEDEKLEAIAKE
RGFSYVRMDGEIGCMVNGAGLAMTTMDMIKLYGGNPANFLDIGGSSNPVKVIEAMRLLLD
DKKVKVVFINIFGGITRCDDVAIGLLQAFEQIQTDIPIIVRLTGTNGNMGRELLRKNNRF
QVAQTMEEATKMAIESLKKESI
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtacacgaatatcaggcaaaggagattttctccacttacggaatacctgtcgag
aggcatgctttatgccatacggcagatggggctgtggctgcttatcaccgaatgggggta
aaccgggtagccataaaagcccaagtgctgaccggcgggcggggaaaagccggcggagta
aagttggccaataatgatagagatgtctaccaatacgctcaaactattttggagatgact
ataaaaggttatcccgtcaccaagattcttcttagtgaggctgtcaacattgcagccgaa
tattacatcagttttacgatagaccgtaatacgcgctctgtcacgctgattatgagtgcg
gccggtggtatggacatcgaggaagtagcccgccaatctccggaaaagataatacgttgc
agcattgatcctctaatcggagttcccgattatctggcacataagtttgctttctctctc
tttgaacaagctgagcaagctaaccggatggcaactattattcaagatctttacaaagca
tttattgaaaaagatgcttcacttgctgaaattaatccattggtacttacccctgttggg
acattattggctattgatgccaaaatggtttttgatgataatgcactttatcgtcatccg
gacttacagaagttatcagagcccacagaagatgagaagttggaagcgattgccaaagaa
agaggattcagctatgtgcgcatggacggcgagataggctgtatggttaatggagccggt
ctggctatgacaactatggatatgatcaagctttatggaggaaatccggctaatttcctt
gatattggcggtagttcaaatcctgtcaaggtgatagaagctatgagattattgctggat
gacaaaaaagtcaaagtagtctttatcaatattttcggaggtatcacccgatgtgacgat
gtagccatcggactcttacaggcgtttgagcagatacaaacggatattcctattattgtg
cggcttacaggcactaatggaaatatgggacgtgaattattgcgtaagaataaccgtttt
caagtggcccagacaatggaagaagctactaaaatggctatagaatcattaaagaaagaa
tcgatatga

DBGET integrated database retrieval system