KEGG   Bacteroides fragilis 638R: BF638R_2367Help
Entry
BF638R_2367       CDS       T01691                                 

Definition
putative xylose isomerase
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
bfg  Bacteroides fragilis 638R
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bfg00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BF638R_2367
   00051 Fructose and mannose metabolism
    BF638R_2367
Enzymes [BR:bfg01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     BF638R_2367
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2774532..2775851
Genome map
AA seq 439 aa AA seqDB search
MATKEYFPGIGKIKFEGKDSKNPMAFRYYDAEKMINGRSMKDWLKFAMAWWHTLCAEGGD
QFGGGTKQFPWNGDPDPVQAAKNKMDAGFEFMQKMGIGYYCFHDVDLVTEADSIEAYEAN
LKELVAYAKQKQAETGIKLLWGTANVFSHARYMNGAATNPDFDVVARAAVQIKNAIDATI
ELGGTNYVFWGGREGYMSLLNTDQKREKEHLAQMLTIARDYGRARGFKGTFLIEPKPMEP
TKHQYDVDTETVIGFLKAHGLDQDFKVNIEVNHATLAGHTFEHELAVAVDNGMLGSIDAN
RGDYQNGWDTDQFPIDNFELTQAMMQIIRNDGLGNGGTNFDAKTRRNSTDPEDIFIAHIA
GMDAMARALESAANLLNESPYQKMLSDRYASFDAGKGKEFEEGKLSLEELVAYAKANGEP
KQTSGQQELYETLVNIYSL
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atggcaacaaaagagtacttcccgggtatagggaaaattaaatttgaaggaaaagacagt
aagaacccgatggcatttcgctattacgatgccgagaaaatgattaacgggcgtagtatg
aaagattggttaaagtttgcaatggcatggtggcatacactttgtgccgaaggcggtgac
cagtttggaggcggaaccaaacagttcccatggaacggtgaccctgatcccgtgcaggca
gccaagaataaaatggatgccggtttcgagtttatgcagaaaatgggcatcgggtattat
tgcttccatgatgtcgatctggttacggaagccgacagcatcgaagcctatgaggccaac
ctgaaagagctggttgcttatgccaagcagaaacaggccgaaacaggcatcaaactgttg
tggggaacggccaatgtattcagccacgcgcgttacatgaacggcgcagccaccaatccc
gattttgatgttgtggcccgtgccgctgtccagataaagaatgcgattgatgccaccatt
gaactgggaggtacgaactatgtcttttggggtggacgcgaagggtatatgtcgttgctg
aatactgatcagaaacgcgaaaaagaacatctggcacagatgctgaccattgcccgtgat
tatggacgtgcacgtggtttcaagggcactttcctaattgaaccgaaacccatggaaccg
acaaagcatcagtatgatgtcgatacagagacagttatcggcttcctgaaggctcacgga
ctggatcaagacttcaaagtgaatatcgaagtgaatcatgccacccttgcaggacatacg
ttcgaacatgaactggcggtggctgtagacaacggaatgttggggtctatcgacgcaaac
cgcggcgattatcagaacggatgggatacggatcaatttccgattgacaacttcgaactg
acacaagccatgatgcagattatccgtaacgacggattgggtaacggcggtacaaacttc
gatgccaaaactcgccggaactctactgacccggaagatatctttatcgcacatattgcc
ggaatggatgctatggcacgtgccttggaaagcgcagccaatctgctcaatgagtctcct
taccagaaaatgttgtccgaccgttatgcctcgttcgatgctggcaagggcaaggagttc
gaagaagggaaactcagcctagaggaactggttgcttatgccaaagccaacggagagccg
aagcagaccagcggccaacaggaactgtatgaaacactcgttaatatctactcattataa

DBGET integrated database retrieval system