KEGG   Bacteroides fragilis 638R: BF638R_2374Help
Entry
BF638R_2374       CDS       T01691                                 

Gene name
ccp
Definition
cytochrome-C peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
bfg  Bacteroides fragilis 638R
Brite
Enzymes [BR:bfg01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     BF638R_2374 (ccp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2782051..2783442)
Genome map
AA seq 463 aa AA seqDB search
MKKSTKFIIALLVTVGALAITYRVVNQAPSKDLAADAQMQEIITSGGCLQCHSGSPDLPF
YANWPVASGMVQKDVTQGYRAFDMTEMAEALKAGKPVGKVALAKVEKVIMDGTMPKHAYY
MVHWGSSVTDAKKEMAMAWVKQHRLAHYANGLAAAEFANEPIRPIADSIPVDMRKVILGD
MLYHDTRLSADNTVSCASCHGLNTGGVDNKQYSEGVGGQFGGVNAPTVYNAAYNFVQFWD
GRAGTLAEQAAGPPLNPVEMACQSFDEIIAKLEQDANFTKAFLAVYPDGYSEQNITNAIE
EFEKTLLTPNSRFDLYLKGEKTAINDIELAGYELFKKYDCATCHVGETLGGQSYELMGVK
RDYFADRGIELTEEDNGRFKQTRNERDKHRFKVPGLRNIALTAPYFHDGSMKTMKEAVDY
MAKYQMDLNLPEDELNKIVAFLETLTGEYKGKPLTNDNQTKAL
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaagtacaaaatttatcatcgcattgcttgtgacagtcggggcactggctatc
acttaccgcgttgtaaaccaagcaccgtcgaaagatcttgctgctgatgctcagatgcag
gaaatcattacttcggggggatgtttacaatgtcattcgggcagtccggaccttcctttc
tatgccaactggcccgttgcaagcggaatggtacagaaagacgtaacgcaaggttatcgt
gctttcgacatgaccgaaatggctgaagctctgaaagccggtaagcctgtcggaaaagta
gcacttgctaaagtcgaaaaagtaatcatggacggaacgatgcccaaacatgcttattac
atggtacattggggatcgagcgtaacagatgccaagaaggaaatggctatggcatgggtt
aaacaacatcgcttggcacattatgctaacggactggctgccgccgagtttgccaatgaa
ccgatacgtcccatcgcagattctattcctgtggatatgcgtaaagtcatcttgggagat
atgctctatcatgacactcgcctttcggccgataacaccgtttcatgtgcttcgtgtcac
ggattgaataccggtggtgtggacaataagcaatattcggaaggtgtaggcggacagttc
ggaggcgtaaatgctccgacagtgtataacgccgcttacaatttcgtccagttctgggat
ggacgtgccggaacacttgccgagcaggctgccggacctcctttgaatccggtcgagatg
gcctgtcagtcatttgatgaaatcattgcgaaactggagcaggatgcaaactttaccaaa
gcctttttggctgtatatcccgatggttattccgaacagaatatcacgaatgcgatcgag
gagtttgaaaagacactgcttactccgaattcccgtttcgacctttatctgaaaggtgaa
aagactgccattaacgatatagagctggccggatacgaattgtttaagaaatacgattgt
gctacatgtcatgtcggtgagacactgggcggccagtcttacgaactgatgggcgtaaag
agagactacttcgcagatcgcggcattgaattgacagaagaagataacggacgtttcaaa
caaacccggaacgaacgtgacaaacatcgctttaaagtgcccggtttgagaaacattgcc
ctgacggctccttacttccatgacggcagtatgaaaacaatgaaagaggctgtagattac
atggccaaatatcagatggatctgaatcttccggaagatgaactgaataaaatcgttgct
tttctggagacactgaccggggagtacaaaggtaagcccctgaccaacgataatcagacc
aaagcattataa

DBGET integrated database retrieval system