KEGG   Bacteroides fragilis 638R: BF638R_2604Help
Entry
BF638R_2604       CDS       T01691                                 

Definition
putative terpenoid biosynthesis-related protein
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
bfg  Bacteroides fragilis 638R
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bfg00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BF638R_2604
Enzymes [BR:bfg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     BF638R_2604
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3063097..3063921
Genome map
AA seq 274 aa AA seqDB search
MITFPNAKINLGLNITEKRPDGYHNLETVFYPIPLEDALEITILNDSKQKFVLHQSGLEI
SGEPETNLVVKAYLLLEQEFQLPPVDIYLYKHIPSGAGLGGGSADAAFMLKLLNEKFNLH
LADEKLEEYAAILGADCAFFIKNKPTFAEGIGNIFSPVDLSLKGYQLVLVKPDVFVSTRD
AFSQIKPHYPDHSLKEIIRRPVSEWKNCMFNDFEKSVFPQYPVIEEIKKELYSKGAIYAA
MSGSGSSVFGLFSPEEKITKMDFEAAFCFQTELK
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgattacatttccgaatgccaaaataaatctgggactgaacattaccgagaaacgtccg
gacggataccacaatctggaaactgtattttatcccatacctctggaggatgcccttgaa
atcacaatattaaatgactcgaaacaaaaatttgtcctgcaccaatccggcctggaaatc
agcggggagccggaaaccaacctggtagtaaaggcatacctgctgctggaacaggaattt
caattacctccggtagacatttatctatataaacatattccttcgggtgccggtttggga
ggtggctcggcggatgctgctttcatgctaaaattgttgaacgaaaaattcaatttacat
ctggcagatgaaaaattggaagagtatgctgccatattaggagctgactgcgcttttttt
attaaaaacaaaccaacctttgcagagggtatcggcaacattttttccccagtcgattta
tcattgaaaggatatcagttggtacttgtaaaaccggatgtctttgtctcgacccgagac
gccttttcacaaataaaacctcactacccggatcattcattgaaagaaattataagacgt
ccggtaagcgaatggaaaaactgcatgttcaatgactttgagaaaagtgtctttccacaa
taccctgtcattgaagaaataaaaaaagaattgtacagcaaaggagccatatatgccgcc
atgtcaggttccggttcatctgttttcggattattctctcccgaagaaaaaataacgaaa
atggattttgaagcagcattctgtttccaaaccgaattgaaataa

DBGET integrated database retrieval system