KEGG   Bacteroides fragilis 638R: BF638R_2653Help
Entry
BF638R_2653       CDS       T01691                                 

Gene name
asnB
Definition
asparagine synthetase B
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
bfg  Bacteroides fragilis 638R
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bfg00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BF638R_2653 (asnB)
Enzymes [BR:bfg01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     BF638R_2653 (asnB)
Peptidases [BR:bfg01002]
 Cysteine Peptidases
  Family C44
   BF638R_2653 (asnB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3123913..3125589
Genome map
AA seq 558 aa AA seqDB search
MCGIAGIFNIKIQSRELRNKALRMARKIRHRGPDWSGMYCGGSAILAHERLSIVDPQSGG
QPLYSSDRRQVLAVNGEIYNHRDIRAQYAGRYEFRTGSDCEVILALYRDKGIHFLEELNG
IFAFALYDEEKDEYLIARDPIGVIPLYIGKDAEGHVYFGSELKALEGFCDEYEPFLPGHY
YHSKERTMKRWYTRDWMEYKEENDKQADSRSPTRQIQDALENAVHRQLMSDVPYGVLLSG
GLDSSVISAIAKKYAAKRIETDGASDAWWPQLHSFAIGLKGAPDLIKAREVAEYIGTVHH
EINYTLQEGLDAIRDVIYFIETYDVTTVRASTPMYLLARVIKSMGIKMVLSGEGADEIFG
GYLYFHKAPNARAFHEETVRKLSKLHLYDCLRANKSLAAWGVEGRVPFLDKEFLDVAMQL
DPEIKMAPGKVIEKKVLREAFADMLPSGIAWRQKEQFSDGVGYSWIDTLKEITATAVSDE
QMAHAAERFPIHTPMNKEEYYYRSIFEEHFPSESAARSVPSIPSVACSTAEALAWDTAFK
NLNDPSGRAVKGVHEEAY
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggaatagcaggaatcttcaatataaagattcagagcagggaactcaggaacaag
gctctccgaatggcacgcaaaatacgtcaccgcgggcccgactggagtggaatgtattgt
ggcggaagtgccatcctggcacacgagcgtctttccatagtcgatccgcaaagcggagga
cagcctctttattcatccgaccggaggcaagtactggcggttaacggcgaaatctataac
caccgtgacatccgcgcccaatatgccggccgctacgagttccggaccgggagtgactgt
gaggtgatcctcgccctttaccgcgacaaaggtattcatttccttgaagagctgaacggc
atcttcgcctttgccctttatgatgaagaaaaagacgaatacctgattgcccgagacccc
atcggtgtaatacctttatatataggaaaggacgccgaaggacatgtctacttcggcagc
gaactcaaagcgctcgaagggttctgcgacgagtacgaacccttcttacccggacactac
tatcacagcaaggaaaggacgatgaaacgctggtacacccgtgactggatggaatataaa
gaggagaacgacaagcaggcggacagccggtctcccacccggcagattcaggacgccctt
gagaatgccgtacaccgtcaactgatgtccgacgtaccttacggagtgcttctttcgggc
gggctggacagttctgttatctctgccattgccaaaaaatatgccgccaaacgcattgaa
accgatggcgcgagcgatgcatggtggccgcagctacactcctttgccatcggactgaaa
ggtgcaccggacctgatcaaagcacgtgaagtagccgaatacatcggtacggttcatcat
gaaataaactacacccttcaggaagggctcgatgccatccgggatgttatctatttcatt
gagacatacgacgtaactaccgtccgtgcttctacaccgatgtatctgttggcacgtgtc
atcaagtcgatgggcatcaagatggtattgagcggtgaaggtgccgacgagatcttcggc
ggctacctttatttccacaaagcacccaatgcccgtgcctttcacgaagagaccgtacgc
aaactgtctaaactgcatctatacgattgtcttcgcgccaataagagcctcgcagcatgg
ggtgtggaaggacgtgtccctttcctcgacaaagagtttctggatgtggccatgcaactc
gatcccgaaataaaaatggctccgggaaaagtcatcgaaaagaaagtcctgcgcgaagct
tttgcggatatgctcccttccggcatcgcctggcgccaaaaagaacagttcagtgacggt
gtgggatatagttggatagatacgctgaaagagattaccgcaacggctgtcagtgacgaa
cagatggcacatgccgcagaacgttttcccatccacacccctatgaataaagaagagtat
tactaccgcagcatcttcgaagagcacttccccagtgaaagcgccgcccgcagcgtaccc
agtatccccagcgtagcctgttcgacagccgaggcactggcatgggacaccgcgttcaag
aacctgaacgatcccagcggacgtgccgtaaaaggagtacacgaagaagcatattaa

DBGET integrated database retrieval system