KEGG   Bacteroides fragilis 638R: BF638R_2678Help
Entry
BF638R_2678       CDS       T01691                                 

Gene name
trpB
Definition
tryptophan synthase beta chain
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
bfg  Bacteroides fragilis 638R
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:bfg01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:bfg00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:bfg00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3149344..3150516
Genome map
AA seq 390 aa AA seqDB search
MKSFLVDQDGYYGEFGGAYVPEILHKCVEELQNTYLDVIESEDFKKEFDQLLRDYVGRPS
PLYPARRLSEKYGCKMYLKREDLNHTGAHKINNTIGQILLARRMGKKRIIAETGAGQHGV
ATATVCALMNMECIVYMGKTDVERQHINVEKMKMLGATVVPVTSGNMTLKDATNEAIRDW
CCHPSDTYYIIGSTVGPHPYPDMVARLQSVISEEIKKQLQEKEGRDYPDYLIACVGGGSN
AAGTIYHYIDDERVRIVLAEAGGKGIETGMTAATIQLGKMGIIHGARTFVIQNEDGQIEE
PYSISAGLDYPGIGPMHANLADKKRAMVLAVNDDEAIRAAYELTRLEGIIPALESAHALG
ALEKITFKPEDVVVLTVSGRGDKDIETYLG
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagttttttagttgatcaggatggctattacggagaatttggaggtgcttatgta
cctgaaatcctccacaagtgtgtagaagagttgcagaatacttatctcgacgtaatagag
agcgaggacttcaagaaagagttcgaccaattgttgcgtgactacgtaggacgcccttcc
ccactctatccggcccgccgcctgtcggagaagtacggttgcaagatgtatctgaaacgg
gaagacctgaatcacacgggtgcccataaaatcaataacaccatcggacaaattctactg
gcaagacgcatgggtaagaaacgtatcattgcggagaccggtgccggacagcacggggtg
gcaacagccacagtctgtgccctgatgaacatggagtgcatcgtatacatgggcaaaacg
gatgtagaacgccagcacatcaatgtagaaaagatgaaaatgctgggagcgacagtcgtt
ccggtcacttcgggcaacatgactctgaaagatgccacgaacgaagccatccgagactgg
tgctgccatccctcggatacgtattacatcatcggttctaccgtagggccgcacccatat
ccggacatggtggcccgtttgcagtcggtcatcagcgaagagataaaaaaacagcttcag
gagaaagaaggacgtgactatccggactatctgattgcctgcgtgggcggaggaagcaac
gctgccggaaccatctatcattatatcgacgacgaacgggtacggatcgtattggccgaa
gccggcggcaagggaattgaaaccgggatgacggcagccaccatccaactcggaaaaatg
gggatcattcatggggcacgtacgtttgtgatccaaaacgaagacggacagattgaggaa
ccttattccatctccgccggactggactatcccggtatcggcccgatgcacgccaacctg
gcagacaaaaaacgggcaatggtactggctgtcaatgatgacgaagccatccgtgccgct
tacgagttgacccggctggaaggaatcattcctgccctggaatcggcccacgcattggga
gccttggaaaaaataactttcaagccggaggatgtagtcgtactgacggtatcgggacgg
ggagataaagatatagaaacttatctgggataa

DBGET integrated database retrieval system