KEGG   Bacteroides fragilis 638R: BF638R_2684Help
Entry
BF638R_2684       CDS       T01691                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
bfg  Bacteroides fragilis 638R
Pathway
bfg00260  Glycine, serine and threonine metabolism
bfg00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bfg01100  Metabolic pathways
bfg01110  Biosynthesis of secondary metabolites
bfg01130  Biosynthesis of antibiotics
bfg01230  Biosynthesis of amino acids
Module
bfg_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bfg00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BF638R_2684 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BF638R_2684 (trpA)
Enzymes [BR:bfg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BF638R_2684 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA HMGL-like
Motif
Other DBs
NCBI-ProteinID: CBW23185
UniProt: E1WQG2
Position
3155457..3156248
Genome map
AA seq 263 aa AA seqDB search
MNRINQLFDSNPRDLLSIYFCAGYPTLEGTTEVIRTLEKHGVNMIEIGIPFSDPMADGMV
IQNAATQALRNGMSLRLLFEQLHDIRRDVKIPLILMGYLNPIMQFGFDNFCRQCAECGID
GVIIPDLPFKDYQEHFRTIAERYDVKVIMLITPETSEERVREIDEHTDGFIYMVSSAATT
GAQQDFDGQKRAYFKKIEKMNLRNPRMVGFGISNEATFRAACENASGAIIGSRFVTLLHE
EKNPEKAITRLKAILNLSSNDLR
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgaacagaataaaccaacttttcgacagcaatcccagggatttgctatccatctatttt
tgtgccggctatcctactctcgaagggacaaccgaagtaatccgtactcttgaaaaacat
ggagtgaacatgattgaaatcggtattcctttcagcgatccgatggctgacggtatggtg
attcagaatgccgccacgcaggccctccgcaacggaatgtcactcagactattgtttgaa
caactgcacgacatccgtcgggatgtaaaaatcccattaatcctgatgggatatctcaac
ccgatcatgcagttcggctttgacaacttctgccggcaatgcgccgaatgcggcattgac
ggagtcatcattcccgaccttcctttcaaagactatcaggaacacttccgcaccattgca
gagcggtatgacgtgaaggtaatcatgcttatcacccctgaaacaagtgaagaacgcgta
cgcgagattgatgaacacaccgacggattcatttatatggtttcatcggctgccaccaca
ggagctcaacaagactttgacgggcaaaaacgtgcttactttaaaaagatcgaaaaaatg
aatcttcgcaatccccggatggtcggtttcggtatcagcaacgaggctaccttccgtgcc
gcttgcgaaaatgcctcgggagccatcatcggcagccgttttgtcactctgctccatgaa
gagaagaacccggagaaagcaatcacacgcttaaaagctattttgaatttatcatccaat
gatttgagataa

DBGET integrated database retrieval system