KEGG   Bacteroides fragilis 638R: BF638R_3114Help
Entry
BF638R_3114       CDS       T01691                                 

Definition
putative exported hexosaminidase
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
bfg  Bacteroides fragilis 638R
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:bfg00520]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:bfg00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3642198..3643847)
Genome map
AA seq 549 aa AA seqDB search
MNKKLLSRLAPGLFAVVLFTACRPAATVKGNLDVIPQPQEIVLARDTTPFIIDRSTTIVY
PATNEKMHRTADFLATFIKEMTGTEVRVSDKEKSSNAIILAVDSTMGHPEGYKLQITPEK
VLLTGGSEAGVFYGIQTIHKALPILKDGKVAAALPAGTVTDFPRFRYRGFMIDVGRHFFP
VSYLKQMIDLMALHNINYFHWHLTEDQGWRIEIKKYPKLTEIGSKRDSTIIDWETKKFDG
KPHSGFYTQDEAREIVRYAADRFITVVPEIDLPGHTTAALASYPELGCTGGPYKVLCSFG
VFPDVLCAGNDQTLQFTKDVLDEIMDIFPSEYIHIGGDECPKSRWEKCPKCQAKIKELGI
KALPKHSKENQLQTYFMSELEKEINAHGRRMLGWDEVLEGGLTPNSTIMSWRGIQGGIEA
ARQHHDVIMTPIQRLYFSNPRINKMTGFEWMNRVYNFEPVPAELTDAEKKFVIGTQGCIW
TEWTADSTKMEWQILPRMAALSEIQWTLPEHKNFERFMERLPEMLKIYSSLDYGYREDVF
AADTLKTHK
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atgaacaagaaactactatcccgtttagctcccggtttgtttgccgttgtgctattcaca
gcctgccgcccggcagccaccgtaaagggtaatttggacgtaatccctcaaccgcaggag
attgtccttgcccgggacactactccttttattattgaccgcagcactacgattgtctac
ccggcaaccaatgaaaagatgcatcgtactgctgattttctggctacttttattaaagaa
atgaccggaaccgaggttcgtgtatcggacaaagagaaaagcagcaatgctattattctt
gctgtagactccacaatggggcatccggaaggttataaacttcaaatcactcctgaaaag
gttcttttgacgggaggcagtgaagccggtgtcttttatggtatccagactattcataaa
gctcttccgatcctgaaagacggtaaggtggcagctgcccttcctgccggtacggttacc
gactttccccgtttccgttaccggggattcatgatcgatgtaggtcgtcacttcttcccg
gtcagctaccttaagcagatgattgacctgatggcactgcataacatcaactactttcat
tggcacctgaccgaagatcagggatggcgaatcgaaatcaagaaatatcccaaactgaca
gagatcggttctaaacgagactctaccattatcgattgggaaaccaagaaattcgacggg
aagccccatagtggattttatacacaggacgaagctcgtgagattgttcgctatgctgcc
gaccgtttcattacagtagttcccgaaattgaccttccgggacatactactgctgcactg
gcttcttatccggaactgggatgtacaggtggtccgtacaaagtactttgctcattcggt
gtcttccctgatgtactctgtgcaggtaatgaccagacacttcagttcaccaaagatgta
ttggatgaaattatggatatcttcccttccgaatatattcatatcggcggtgacgaatgt
ccgaaaagccgttgggagaagtgccccaaatgtcaggctaaaattaaggagttgggtatc
aaagccctgcctaaacattcgaaagagaatcagttgcaaacctacttcatgtccgagctg
gagaaagaaatcaatgctcacggacgccgtatgctgggatgggatgaggtattggaagga
ggtctgactccgaactccactatcatgtcatggagaggaatccagggaggaatcgaagct
gcccgccagcatcatgatgtcattatgactcctattcagcggctctatttcagtaatccg
cgtatcaataaaatgacgggattcgaatggatgaaccgtgtatacaactttgaaccggta
cctgcagaactgaccgatgcggaaaagaagtttgtgattggtactcaaggatgtatctgg
accgaatggacagccgattcaacgaagatggagtggcagattctgccccgaatggctgct
ttgtccgaaatacaatggacattgccggagcataagaactttgagcgtttcatggagcgc
ctacccgagatgctgaagatttattcttctctggattatggttatcgggaagatgtattc
gcggcggataccttgaagactcataaataa

DBGET integrated database retrieval system