KEGG   Bacteroides fragilis 638R: BF638R_3117Help
Entry
BF638R_3117       CDS       T01691                                 

Gene name
gpmA
Definition
(GenBank) putative 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bfg  Bacteroides fragilis 638R
Pathway
bfg00010  Glycolysis / Gluconeogenesis
bfg00260  Glycine, serine and threonine metabolism
bfg00680  Methane metabolism
bfg01100  Metabolic pathways
bfg01110  Biosynthesis of secondary metabolites
bfg01120  Microbial metabolism in diverse environments
bfg01130  Biosynthesis of antibiotics
bfg01200  Carbon metabolism
bfg01230  Biosynthesis of amino acids
Module
bfg_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bfg_M00002  Glycolysis, core module involving three-carbon compounds
bfg_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bfg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BF638R_3117 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    BF638R_3117 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BF638R_3117 (gpmA)
Enzymes [BR:bfg01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BF638R_3117 (gpmA)
Membrane trafficking [BR:bfg04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    BF638R_3117 (gpmA)
Exosome [BR:bfg04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BF638R_3117 (gpmA)
  Exosomal proteins of melanoma cells
   BF638R_3117 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: CBW23592
UniProt: E1WTL5
Position
complement(3648235..3648981)
Genome map
AA seq 248 aa AA seqDB search
MKKIVLLRHGESAWNKENRFTGWTDVDLTEKGIAEACKAGELLKENGFNFDKAYTSYLKR
AVKTLNCVLDRMDQDWIPVEKSWRLNEKHYGDLQGLNKSETAAKYGDEQVLIWRRSYDIA
PNALSEDDPRNPRFENRYQEVPDAELPRTESLKDTIERIMPYWKCIIFPNLKTADEILVV
AHGNSLRGIIKHLKHISDEEIVKLNLPTAVPYVFEFSDELNLEKDYFLGDPEEIRKLMEA
VANQGKKK
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagattgtattgctccgtcatggagaaagtgcatggaacaaagagaaccgtttt
accggttggacagatgtcgatctgacagaaaaaggaattgccgaagcctgtaaagcaggc
gaactactgaaagagaatggatttaacttcgataaagcttatacgtcataccttaaacga
gcggtgaaaacgctgaattgcgtactcgaccggatggatcaggactggattccggtagag
aaaagctggcgcctgaatgaaaaacattacggcgatctgcaaggactgaacaaaagcgaa
acagccgctaaatacggggatgaacaggtgcttatctggcgcaggagttatgatatagct
cccaatgccctgtcggaagacgatccgagaaatccccgctttgagaatcgttatcaggaa
gtacccgatgcggaacttccccggacagaatctctgaaagataccatcgaacgtatcatg
ccttattggaagtgtatcatcttcccgaatctgaaaacggctgatgaaattctggttgtt
gcccacggaaatagtttgcgcggcatcatcaagcacttgaagcacatctccgatgaagag
atcgtaaaactgaatctgccgactgccgtcccttacgtatttgagttcagtgacgaactg
aatctggaaaaagactatttcctgggtgatcccgaagaaatccgtaagttgatggaagcg
gttgccaaccagggaaagaaaaaataa

DBGET integrated database retrieval system