KEGG   Bacteroides fragilis 638R: BF638R_3504Help
Entry
BF638R_3504       CDS       T01691                                 

Gene name
ruvA
Definition
putative holliday junction DNA helicase
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
bfg  Bacteroides fragilis 638R
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:bfg03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4136681..4137286)
Genome map
AA seq 201 aa AA seqDB search
MIEYIKGEIAELSPATAVIDCNGLGYAVNISLNTYSAIQGKSSCKLYIYEAIREDAYVLY
GFADKQERELFLLLISVSGIGGNTARMILSALSPAELVNVISTENANMLKTVKGIGLKTA
QRVIVDLKDKIKTGAMAATAVGGAAGALLPAMNAEVQEEAIAALTMLGFAAAPSQKAVLA
ILKEEPDAPVEKVIKLALKRL
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgatagaatacatcaaaggcgaaattgccgaactgagtccggcaaccgcagttatcgat
tgtaacggattaggatatgccgttaatatatcactcaacacttattctgccattcagggt
aagagcagttgtaaactctatatctacgaagccatccgcgaagatgcttacgttttatat
ggctttgccgacaagcaggaacgggaacttttcctgctgctgatttccgtttcgggtatt
ggaggaaacacggcccgtatgattctttctgctctttcaccggccgaactggtgaatgtg
atcagtaccgaaaatgccaatatgctgaagacggtgaaaggtatcggactgaagaccgca
cagcgtgtcattgtcgatttgaaagataaaattaaaaccggtgccatggctgcaactgcc
gtgggaggtgctgccggtgctttgttgccggcaatgaatgcggaagtacaggaagaggcc
atcgctgcattgaccatgctcggatttgccgctgcaccttcacagaaggcggtgcttgcc
atattgaaagaagaacccgatgctccggtggagaaagtcattaagctggctttaaaaaga
ctttga

DBGET integrated database retrieval system