KEGG   Bacteroides fragilis 638R: BF638R_3515Help
Entry
BF638R_3515       CDS       T01691                                 

Definition
putative terpenoid biosynthesis related reductoisomerase
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
bfg  Bacteroides fragilis 638R
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:bfg00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4148603..4149769)
Genome map
AA seq 388 aa AA seqDB search
MNEIKKKQIAILGSTGSIGTQALQVIEEHPELYEVYALTANNKVDLLIAQARKFMPEAVV
IANEEKYAQLKEALSDLPVKVYAGAAALCQIVESGPIDVVLTAMVGYAGLKPTMNAIRAG
KAIALANKETLVVAGELINQLARQYRTPILPVDSEHSAVFQCLAGEVGNPIEKVILTASG
GPFRTCTMEQLKTVTKVQALKHPNWEMGAKITIDSASMMNKGFEVIEAKWLFGVQPGQIE
VVVHPQSVIHSMVQFEDGAIKAQLGMPDMRLPIQYAFSYPDRINSSFDRLDFSKCTNLTF
EQPDTKRFRNLALAYESMYRGGNMPCIVNAANEVVVAAFLRDEISFLGMSDVIEHTMGQV
SFVQTPTYDDYVATDAEARRIASELICK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaacgagataaagaagaaacaaatagctatcttaggctctacgggttctattggtacc
caggccttgcaggttatcgaagagcatcccgaactgtacgaggtgtatgcactgactgcc
aataataaggtagatctcctgatagcccaggcacgtaagtttatgcctgaggctgtagtt
atagccaatgaagagaaatatgcccaactgaaagaggctctcagcgacctgcctgttaag
gtgtatgcaggtgctgccgcgttatgccagattgtagagtccggccctatcgatgtagtc
ctgaccgctatggtggggtatgcgggattgaagccgaccatgaatgccattcgtgccgga
aaagccattgcccttgccaataaagagacactggtagttgccggagagttgattaatcag
ttagcccggcaataccgtacaccgattcttcctgtcgattccgaacattcggcagtattc
cagtgtttggccggagaggtaggcaatccgatagagaaagttatcctgactgcttccgga
ggtcctttccgtacatgtactatggaacagttgaagactgtgacaaaagtacaggctctc
aaacatccgaattgggaaatgggagctaagattactattgattctgcctcgatgatgaac
aaggggttcgaagtgatcgaagccaaatggttgtttggcgtacagcccggccagattgag
gtggtggtacatccgcagtcggttattcattcgatggtgcagtttgaggatggagcaata
aaggcccagttgggaatgcccgatatgcgtctgcccattcagtatgctttctcttatccc
gatcgtatcaattcgtctttcgaccggcttgatttttcgaaatgtacgaaccttactttt
gagcaacccgataccaagcggttccgtaatctggcattggcctatgaatcgatgtatagg
ggagggaatatgccttgcatcgtaaatgcggccaacgaggtggttgtggcggcttttctt
cgtgatgaaatcagctttctcggcatgagtgatgtgatagaacataccatggggcaggtg
tctttcgtacagactcctacttacgacgactatgtggcaaccgatgcagaagcacgccgg
attgccagtgaattaatatgtaaataa

DBGET integrated database retrieval system