KEGG   Bacteroides fragilis 638R: BF638R_3524Help
Entry
BF638R_3524       CDS       T01691                                 

Gene name
gmk
Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
bfg  Bacteroides fragilis 638R
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:bfg00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    BF638R_3524 (gmk)
Enzymes [BR:bfg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     BF638R_3524 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4155863..4156477
Genome map
AA seq 204 aa AA seqDB search
MNPTERITTPHKTGEAKVIIFSAPSGSGKSTIINYLLAQKLNLAFSISATSRPPRGNEKH
GVEYFFLSPDEFRQRIANNEFLEYEEVYTDRFYGTLKAQVEKQLAAGQNVVFDVDVVGGC
NIKKYYGERALSLFIQPPCIDELRRRLIGRGTDTPEVIESRIAKAEYELSFAPKFDKVII
NDDLETAKAHALKVIKEFLGIDTE
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgaacccaactgaaagaataactaccccacacaaaacgggtgaagccaaagtaatcatc
ttttctgctccttccggatcgggtaagtcaacaatcataaattatttgttggctcaaaag
ttgaatcttgcattctcgatctcagccaccagtcgtcccccccggggaaacgaaaagcat
ggagtagaatattttttcctctctcccgatgaattccgtcaacgcattgcaaacaatgaa
ttcctggaatacgaggaagtatataccgaccggttctacggcactctgaaagcacaggta
gaaaaacagcttgctgccggacaaaatgttgtattcgatgtagatgtcgtaggtggctgt
aacatcaagaaatattatggtgaacgggcgctttcgctttttatccagcctccctgcatt
gacgaactgcgccgccgtctgatcggacgcggaacagatactcccgaagtgatcgagagt
cggatagccaaagccgaatatgaattaagctttgctccgaaatttgataaggttatcatt
aatgacgacctggaaacagccaaggcacacgcattgaaagtgattaaagagtttctgggc
atcgatactgaataa

DBGET integrated database retrieval system