KEGG   Bacteroides fragilis 638R: BF638R_3549Help
Entry
BF638R_3549       CDS       T01691                                 

Gene name
dfrA
Definition
putative dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
bfg  Bacteroides fragilis 638R
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bfg00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BF638R_3549 (dfrA)
   00670 One carbon pool by folate
    BF638R_3549 (dfrA)
Enzymes [BR:bfg01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     BF638R_3549 (dfrA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4183660..4184160
Genome map
AA seq 166 aa AA seqDB search
MSRISIIAAVDSRMAIGFQNKLLFWLPNDLKRFKALTTGNTIIMGRKTFESLPKGALPNR
RNVVLSSNPAAECPGAEVFTSLEAALESCQAEEKVYIIGGASVYRQAISLADELCLTEVN
DTAPEADAFFPAVDTTIWHEKSREVHPADEKHLCSYAFVDYVRGID
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atgagtagaatcagcattatcgccgccgtagacagccggatggctatcggatttcaaaat
aaacttttattctggctgcccaatgacctgaaacgtttcaaggcgttgaccacaggaaac
acaatcatcatgggacgcaaaacgttcgaatcactcccgaaaggggcattacccaatcgc
cggaatgtagtcctttcttccaatccggcagccgaatgtccgggagcagaagtattcact
tcgctggaagccgctttggaaagctgccaagccgaagaaaaagtatacatcatcggaggg
gcaagcgtctatcgccaggccatatccctggccgacgagctgtgcctgaccgaagtaaat
gatacagcgccggaagccgatgccttcttcccggctgtagacacaactatatggcacgaa
aaaagcagagaagttcatcctgccgatgaaaaacatctctgctcgtatgcttttgtagat
tacgtacggggaatcgattaa

DBGET integrated database retrieval system