KEGG   Bacteroides fragilis 638R: BF638R_3566Help
Entry
BF638R_3566       CDS       T01691                                 

Definition
putative membrane dehydrogenase protein
Orthology
K12343  
3-oxo-5-alpha-steroid 4-dehydrogenase 1 [EC:1.3.1.22]
Organism
bfg  Bacteroides fragilis 638R
Brite
Enzymes [BR:bfg01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     BF638R_3566
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4197582..4198343)
Genome map
AA seq 253 aa AA seqDB search
MSIESFNLLLLVMGLVALVVFIALYFVRAGYGMFRSRSWGISVNNKIAWILMEAPVFLVM
GWLWWHSDRRFLPVELTFFLFFQLHYFQRAFVFPFLMKGKSKMPVLILLMGVIFNILNGL
MQGEWIFYLAPSDYYTPGWLLTPCFWIGTLLFFAGMGINWHSDSVIRHLRAPGDTRHYLP
QRGMYRYVTSANYLGEIVEWVGWAILTWSLSGCIFAWWTVANLVPRADAIWHRYREEFGT
QVGSKKRIFPFLY
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgagtatagaaagctttaatctgcttcttttagtaatgggcctggtggctttggtcgta
ttcatagccctttattttgtcagggcgggatatggcatgtttcgcagccgttcctgggga
atctcggtgaataataagatagcctggattctgatggaagctcctgtctttctggttatg
ggatggttgtggtggcattccgaccgacgttttttacctgtcgaactcactttctttctt
tttttccaactacattacttccaaagggcttttgtttttcctttcctgatgaaaggaaag
agcaagatgccggtactcattcttttgatgggagtgatctttaatattctcaacggactg
atgcagggagaatggatattctatcttgctccctcggactattatacacccggatggttg
ctgactccttgcttttggataggaacccttttattttttgccggaatggggatcaactgg
cattcggattcagtcatccgtcatctgcgtgctcccggagatacccgtcattaccttcct
caaagaggcatgtatcggtatgtgacctctgccaattatttgggtgaaattgtagagtgg
gtaggctgggctattctcacttggtctttgtccggatgtattttcgcctggtggactgtt
gccaatcttgttccgagagcagatgctatctggcatcgctatcgggaagagtttgggacg
caggtcggatcgaagaaacgaatttttcctttcttatattaa

DBGET integrated database retrieval system