KEGG   Bacteroides fragilis 638R: BF638R_3693Help
Entry
BF638R_3693       CDS       T01691                                 

Definition
putative alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
bfg  Bacteroides fragilis 638R
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bfg00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BF638R_3693
Enzymes [BR:bfg01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     BF638R_3693
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4346992..4349694
Genome map
AA seq 900 aa AA seqDB search
MIVTFHIEYRTSWGEEVRILGSVPELGKNNPEQAVALTTVDGIHWSNEISIQLPAEGVVE
YSYHIYRDGKTIRTEWNSFPRRIYLPADVKKSLRINDCWKNLPEQQYFYSSAFTEALLAH
RERSAIPKSYKKGLMIKAYAPRINSKYCLAICGNQKALGNWDPDKAWPMSDANFPEWQAE
LDASKLEFPLEYKFVLYNKEEKRAEAWENNPNRYLAAPEIKANETLVIADRYAYFNIPSW
KGAGVAVPVFSLKSEKSFGVGDFGDLKRMVDWAVSTNQKVVQILPINDTTMTHTWTDSYP
YNSISIYAFHPMYADLKQMGNLKDKETAATFNRKQKELNALSAIDYEAVNRVKWEYFHQI
FKQEGEKVLASKAFRSFFEANKDWLQPYAAFSYLRDLYHTPNFREWPQYSEYNAQEIEEL
CRPDTADYAHIAIYFYIQFNLHLQLLEATTYAREHGVVLKGDIPIGISRNSVEAWTEPYY
FNLNGQAGAPPDDFSVNGQNWGFPTYNWDVMENDGYKWWMKRFQKMAEYFDAYRIDHILG
FFRIWEIPMNAVHGLLGQFVPALPMSREEIESYGLSFREEFLRPYIHEYFLGQVFGPHTD
YVKQTFIEPTETYEVYRMRPEFDTQRKVEAFFAGKNDEDSIWVRDGLYALISDVLFVPDR
KDPNLYHPRIGVQHDFIYRALNDWEKTAFNRLYDQYYYHRHNDFWQQQAMKKLPQLTQST
RMLVCGEDLGMIPDCVAWVMNDLRILSLEIQRMPKNPAEEFGRLNEYPYRSVCTFSTHDM
STLRGWWEEDYQQTQRYYNQMLGHYGTAPAIATPELCEEVVRNHLYSNSILCILSLQDWL
SMDGKWRNPNVQEERINIPANPRHYWRYRMHLTLEQLMKAESLNEKIRELVKQTGRNPEK
NT seq 2703 nt NT seq  +upstreamnt  +downstreamnt
atgatagttacatttcatattgaatatcgcacaagctggggagaagaagtcagaatatta
ggttctgtccccgaacttgggaaaaataatccggagcaggctgtagcccttaccacagta
gacggcattcattggagcaatgaaatatccattcaattgccggccgaaggggttgtcgaa
tacagttatcacatatatcgtgacggtaagaccatccgtaccgaatggaactcctttccg
cgacgcatctatctgccggccgacgttaagaaaagcctgcgcatcaacgactgctggaag
aatcttccggagcagcaatacttctacagttcggcatttactgaagcactgctggcgcac
cgcgaacgaagcgcaatccccaaaagctacaaaaaaggattgatgatcaaggcttatgct
ccacgcatcaacagcaagtactgcctggccatctgtggtaaccagaaagcactcggcaac
tgggacccggacaaggcatggcccatgagtgatgccaactttccggaatggcaagccgaa
ctggatgcttccaaactggaatttccactagaatacaaatttgtattgtacaataaagaa
gagaagcgtgccgaagcttgggagaataaccccaaccgctatctggctgctcccgaaatc
aaagcaaacgagacattggtcattgccgaccgatatgcctactttaatattccttcctgg
aaaggtgcaggcgtagctgtccctgtattctcactaaagtcggaaaaaagtttcggtgta
ggagacttcggagacctgaagagaatggtggactgggcggtcagtaccaaccagaaggta
gtacagatcttaccgatcaacgataccaccatgactcatacatggacagactcttatccc
tacaacagcatttccatttatgccttccacccgatgtatgccgaccttaaacagatgggc
aacctgaaggataaagaaactgctgctaccttcaaccgaaaacaaaaagaactgaatgca
ctttccgccatcgactacgaagctgtcaaccgggtgaaatgggaatatttccatcagata
ttcaagcaagaaggagaaaaggtgctggcttcgaaagccttccgcagcttcttcgaagcc
aacaaagattggctgcaaccgtatgctgcattcagctacctgcgcgatttataccataca
ccgaacttccgcgaatggccccaatactcggagtacaatgctcaagagattgaagaactg
tgccgccccgacacggcggactatgcccatatcgccatctacttctatatccagttcaat
cttcacctgcaattgctcgaagccaccacttatgcccgcgagcatggagtagtgctgaag
ggggacatccccatcggtatcagtcgcaacagtgtagaagcctggacagaaccttattat
ttcaacctcaacggacaggccggtgctccacccgatgatttctctgtcaacgggcagaac
tggggtttccccacctataactgggatgtgatggagaacgacggttataaatggtggatg
aaacgtttccaaaagatggctgaatactttgacgcctaccgcatcgaccacattctggga
ttcttccgcatctgggaaatcccgatgaatgccgtgcatggattgctgggacagtttgta
cccgcccttcccatgagccgtgaagagatagaaagttacggactctctttccgtgaagag
ttcctgcggccgtatatccatgaatatttcctcggacaagtgttcggaccacataccgac
tatgtaaagcagacgttcatcgaaccgactgaaacttacgaggtataccgtatgcgtccg
gaatttgatacccaacgcaaggtagaagccttctttgccggcaagaacgacgaagacagt
atatgggtcagagacggattatatgccctgatcagtgacgtattatttgttcccgaccgc
aaagacccgaacctgtaccatccccgcatcggcgtgcagcacgactttatctaccgtgcc
ctgaacgactgggaaaaaacagcattcaaccgcctttacgaccagtactactatcatcgt
cacaatgacttctggcaacagcaagccatgaagaaattgccacagcttacccagtctacc
cgcatgctggtatgtggcgaagacttaggcatgattcccgactgcgtggcatgggtgatg
aatgacttacgtatcctgagtctcgaaattcagcggatgcccaagaatccggcagaagaa
ttcggaaggctgaacgaatatccgtaccgttcggtctgcaccttctccacccacgatatg
tcgaccctgcggggctggtgggaagaagactatcagcagacccaacgctactacaatcag
atgctgggacattatggtaccgctcctgccatagcaacgccggagctgtgcgaagaagta
gtacgcaatcacctttacagcaattccatcctctgcatcctatccctgcaagactggctg
tcgatggatggaaaatggcgcaacccgaatgtacaggaagaacggatcaatatccccgcc
aatccgcgtcattactggcgctaccggatgcacctgacactggaacaactgatgaaagca
gaaagcctgaatgaaaaaatcagggaattggtgaagcagacaggcagaaatccggaaaag
taa

DBGET integrated database retrieval system