KEGG   Bacteroides fragilis 638R: BF638R_3804Help
Entry
BF638R_3804       CDS       T01691                                 

Gene name
tpiA
Definition
(RefSeq) putative triosephosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bfg  Bacteroides fragilis 638R
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bfg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BF638R_3804 (tpiA)
   01230 Biosynthesis of amino acids
    BF638R_3804 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BF638R_3804 (tpiA)
   00051 Fructose and mannose metabolism
    BF638R_3804 (tpiA)
   00562 Inositol phosphate metabolism
    BF638R_3804 (tpiA)
Enzymes [BR:bfg01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     BF638R_3804 (tpiA)
Exosome [BR:bfg04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   BF638R_3804 (tpiA)
  Exosomal proteins of bladder cancer cells
   BF638R_3804 (tpiA)
  Exosomal proteins of melanoma cells
   BF638R_3804 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4478619..4479374)
Genome map
AA seq 251 aa AA seqDB search
MRKNIVAGNWKMNKTLQEGIALAKELNEALANEKPNCDVIICTPFIHLASVTPLVDAAKI
GVGAENCADKESGAYTGEVSAAMVASTGAKYVILGHSERRAYYGETVEILKDKVKLALAN
GLTPIFCIGEVLEEREANKQNEVVAAQLASVFDLSAEDFSKIVLAYEPVWAIGTGKTASP
AQAQEIHAFIRSAVAEKYGKEIADNTSILYGGSCKPSNAKELFANPDVDGGLIGGAALKV
ADFKGIIDAFN
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgagaaagaacattgttgcaggaaactggaaaatgaacaaaacccttcaggagggtatt
gctcttgcaaaagaactgaatgaagctttggctaacgaaaagcctaactgtgatgtcatt
atctgtactccgtttattcaccttgcttctgttactcccttggtagatgcagctaagatc
ggtgtaggtgctgagaactgtgctgacaaagaatccggagcttatacaggtgaagtatcg
gctgctatggtagcttctaccggtgctaaatacgttattctgggtcactcggaacgtcgt
gcttactacggtgaaacggttgagatcctgaaggacaaagtgaaactggctttggcaaat
ggtctgactccgattttctgtatcggtgaggttctggaagaacgcgaggctaacaaacag
aacgaggttgttgctgctcagttggcatctgtattcgatctttcggcagaagatttctct
aagatcgttctggcttacgaaccggtttgggctatcggtaccggtaaaacagcttctcct
gctcaggctcaggaaatccatgcgttcatccgttcggctgttgctgagaaatacggaaaa
gaaatcgctgacaacacttcaatcctttatggtggtagctgcaaaccttctaatgctaaa
gaactgtttgctaatcctgatgttgacggtggtctgatcggtggtgctgccctgaaagtt
gctgacttcaaaggtatcattgacgcattcaattaa

DBGET integrated database retrieval system