KEGG   Bacteroides fragilis 638R: BF638R_4265Help
Entry
BF638R_4265       CDS       T01691                                 

Definition
putative aldose 1-epimerase precursor
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
bfg  Bacteroides fragilis 638R
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:bfg00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:bfg00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5031115..5032254
Genome map
AA seq 379 aa AA seqDB search
MNRMKTKLIILLILTTMIHTNTVNAQHSQLKRADFQQTIDGKQTDLYFLRNKNGIEIAIT
NFGGRVVEFWTPDKKGHFEDIVLGHDHVDKYLHYKGERFLGATIGRYGNRINKGKFTLNG
QTYQLPINDTPNSLHGGFKGFDMVVWDVEQPDSQTLQLTYLSKDGEEGYPGNLQVSMSYK
LTDKNEFIITHQAQTDKETVINLTHHSFFNLHGAGNKDINDHILMINADKFTPVDQTLIP
TGILQDVEGTPMDFRRPTPIGKRVNDSFEQLEFGHGYDHNWVLNRKTSNTPELAATVYEP
ASGRYLEVWTTEPGLQFYGGNFFDGTMTGKHEKKYNYRASLALETQHYPDSPNQPAFPST
TLLPGDTYKHICIYKINVQ
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgtatgaaaacaaaactgatcattttattaatactcacaaccatgatacacaca
aacaccgtaaatgcccaacattcacaattgaaaagagccgattttcaacaaacaattgac
ggaaagcaaaccgatctctactttctgagaaacaaaaacggcattgaaattgccatcacc
aatttcggaggacgagtcgttgaattctggactccggataaaaaagggcattttgaagac
atcgtcctcggacacgatcatgtggacaaatatctccattataaaggtgaaagatttttg
ggagccactatcggacggtatggcaaccggatcaacaaaggaaagtttaccctgaacgga
caaacttaccagttacccatcaatgatactcccaacagtctacatggtggctttaaagga
tttgatatggtagtatgggatgttgagcagccggacagccagactttacaactcacgtat
ttatccaaagatggtgaagaggggtatccgggaaatctccaagtatccatgagttacaag
cttacggataaaaacgaatttattatcactcaccaggctcaaacagacaaagaaacggtc
atcaacctcacccatcattccttcttcaacctgcacggtgcaggcaataaggatatcaat
gaccatatactcatgatcaatgcggataagtttactcctgtcgatcagaccctaatcccc
accggtattctccaggatgtagaagggaccccgatggattttcgtcgccccacacctatc
ggaaagcgagtaaatgattcgttcgagcaactggagttcggtcacggctacgaccataat
tgggtattgaatcgcaaaacctccaacacccccgaactggcagcaaccgtttatgaaccc
gcctcaggaagatatcttgaagtatggaccaccgaacccggactacaattctatggcggt
aacttctttgatggtacaatgaccggaaagcacgaaaagaaatacaactaccgggcttcc
ctcgcattggaaacccagcactatccggatagtcctaaccaaccggcattcccgtcaaca
accctcttacccggagatacttacaaacatatatgcatctataaaatcaatgtacaatga

DBGET integrated database retrieval system