KEGG   Bacteroides fragilis 638R: BF638R_4265Help
Entry
BF638R_4265       CDS       T01691                                 

Definition
(GenBank) putative aldose 1-epimerase precursor
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
bfg  Bacteroides fragilis 638R
Pathway
bfg00010  Glycolysis / Gluconeogenesis
bfg00052  Galactose metabolism
bfg01100  Metabolic pathways
bfg01110  Biosynthesis of secondary metabolites
bfg01120  Microbial metabolism in diverse environments
bfg01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bfg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BF638R_4265
   00052 Galactose metabolism
    BF638R_4265
Enzymes [BR:bfg01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     BF638R_4265
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: CBW24687
UniProt: E1WQR1
Position
5031115..5032254
Genome map
AA seq 379 aa AA seqDB search
MNRMKTKLIILLILTTMIHTNTVNAQHSQLKRADFQQTIDGKQTDLYFLRNKNGIEIAIT
NFGGRVVEFWTPDKKGHFEDIVLGHDHVDKYLHYKGERFLGATIGRYGNRINKGKFTLNG
QTYQLPINDTPNSLHGGFKGFDMVVWDVEQPDSQTLQLTYLSKDGEEGYPGNLQVSMSYK
LTDKNEFIITHQAQTDKETVINLTHHSFFNLHGAGNKDINDHILMINADKFTPVDQTLIP
TGILQDVEGTPMDFRRPTPIGKRVNDSFEQLEFGHGYDHNWVLNRKTSNTPELAATVYEP
ASGRYLEVWTTEPGLQFYGGNFFDGTMTGKHEKKYNYRASLALETQHYPDSPNQPAFPST
TLLPGDTYKHICIYKINVQ
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgtatgaaaacaaaactgatcattttattaatactcacaaccatgatacacaca
aacaccgtaaatgcccaacattcacaattgaaaagagccgattttcaacaaacaattgac
ggaaagcaaaccgatctctactttctgagaaacaaaaacggcattgaaattgccatcacc
aatttcggaggacgagtcgttgaattctggactccggataaaaaagggcattttgaagac
atcgtcctcggacacgatcatgtggacaaatatctccattataaaggtgaaagatttttg
ggagccactatcggacggtatggcaaccggatcaacaaaggaaagtttaccctgaacgga
caaacttaccagttacccatcaatgatactcccaacagtctacatggtggctttaaagga
tttgatatggtagtatgggatgttgagcagccggacagccagactttacaactcacgtat
ttatccaaagatggtgaagaggggtatccgggaaatctccaagtatccatgagttacaag
cttacggataaaaacgaatttattatcactcaccaggctcaaacagacaaagaaacggtc
atcaacctcacccatcattccttcttcaacctgcacggtgcaggcaataaggatatcaat
gaccatatactcatgatcaatgcggataagtttactcctgtcgatcagaccctaatcccc
accggtattctccaggatgtagaagggaccccgatggattttcgtcgccccacacctatc
ggaaagcgagtaaatgattcgttcgagcaactggagttcggtcacggctacgaccataat
tgggtattgaatcgcaaaacctccaacacccccgaactggcagcaaccgtttatgaaccc
gcctcaggaagatatcttgaagtatggaccaccgaacccggactacaattctatggcggt
aacttctttgatggtacaatgaccggaaagcacgaaaagaaatacaactaccgggcttcc
ctcgcattggaaacccagcactatccggatagtcctaaccaaccggcattcccgtcaaca
accctcttacccggagatacttacaaacatatatgcatctataaaatcaatgtacaatga

DBGET integrated database retrieval system