KEGG   Bacteroides fragilis 638R: BF638R_4272Help
Entry
BF638R_4272       CDS       T01691                                 

Definition
(GenBank) putative alpha-galactosidase/melibiase
  KO
K07407  alpha-galactosidase [EC:3.2.1.22]
Organism
bfg  Bacteroides fragilis 638R
Pathway
bfg00052  Galactose metabolism
bfg00561  Glycerolipid metabolism
bfg00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:bfg00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    BF638R_4272
  Lipid metabolism
   00561 Glycerolipid metabolism
    BF638R_4272
   00600 Sphingolipid metabolism
    BF638R_4272
Enzymes [BR:bfg01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     BF638R_4272
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Melibiase_2 He_PIG_assoc Melibiase_2_C He_PIG Melibiase
Motif
Other DBs
NCBI-ProteinID: CBW24693
UniProt: E1WQR7
Structure
PDB: 

Jmol
Position
complement(5037207..5038697)
Genome map
AA seq 496 aa AA seqDB search
MKITSYVSFLYCLCLMLASPTVQASEVRTAIFEGKPCINPPHVVGNYPATPFLFYIPTSG
ERPIKWHAENLPKGLKLDKETGIIKGKVVEKGTYKVMLKAENALGTDTQELLINIGDELL
LTPPMGWNSWNTFGRHLTEELLLQTADAMVENGMRDLGYAYINIDDFWQLPERGADGHIQ
IDKTKFPRGIKYVADYLHERGFKLGIYSDAADKTCGGVCGSYGYEEIDARDFASWGVDLL
KYDYCNAPAGRVEAMERYEKMGRALRATDRSIVFSICEWGQREPWKWAKKVGGHLWRVSG
DIGDLWNRSTDEKGGLRGILNILEINAPLSEYARPGGWNDPDMLVVGIGGKSKSIGYESE
GCTNEQYQSHFALWCMMASPLLCGNDVRQMNDSTLQILLNKDLIAIDQDPLGIQAERAIR
ADHYDVWVKPLSDGSKAIACLNRISGPVDVELNVKTVEGLSLDRVYDVIEGSLVAEASTG
WVVKLAPGECKVFICK
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattacaagttatgtttcttttttatattgcttatgtctgatgctggcgagtccg
acagtacaggcgagcgaagtgcgaaccgctatttttgaggggaaaccgtgtattaatccc
cctcatgtggtgggaaactatcctgctaccccttttttgttttatattcccacctccgga
gaacgaccgataaagtggcatgctgaaaatcttcccaagggattgaagctggataaagaa
acggggataatcaagggaaaagtagtagaaaagggaacgtacaaagtgatgctgaaagct
gagaatgcccttggaaccgatacacaggaactactgattaatataggagatgagttgttg
ctgactcctccgatggggtggaacagttggaatacattcggacgtcacctgacagaggag
ctactgttgcaaactgcagatgcaatggtagaaaacggaatgcgtgatttggggtatgct
tatattaatatcgatgacttttggcagttgcctgaaaggggagctgacggtcatatccaa
attgataaaacaaagttcccgagaggcatcaaatatgtggccgattacttgcatgagcga
ggattcaaacttggaatttattcggatgccgctgataaaacttgtggtggggtttgtggc
agttatggatatgaagaaattgatgcacgggatttcgcatcctggggtgttgatcttttg
aagtatgactattgcaatgcacctgccggaagagtagaagcgatggaaagatatgagaag
atggggagggcattgagagcgaccgaccgttctatcgtcttttcaatttgtgagtgggga
cagcgtgaaccttggaaatgggcgaagaaagtcggcggacatttatggcgagtatccggt
gatattggcgacttgtggaatcgttcgacagacgaaaagggaggtttacgtggcattttg
aacattcttgaaataaatgcaccgcttagtgaatatgcaagacccggcggatggaatgat
ccggatatgcttgttgtggggattggcggaaaaagtaagagtatcggttatgaatcggaa
ggttgtacgaatgaacaatatcagtcccactttgctctctggtgcatgatggcttctcca
ttactctgtggcaatgatgtacggcagatgaatgatagtacgttacaaatacttttgaat
aaggatctgattgctatcgatcaggatccgctgggcattcaggcagagcgtgccattcgt
gccgatcattatgatgtctgggtgaagccgttgagtgacggaagcaaagcaatagcttgt
ctgaaccggatatccggacccgtagacgtggagttgaatgtaaagacggtagaaggattg
tcattggatcgggtatatgatgttatagaaggcagccttgtggctgaggcttctaccgga
tgggtcgtaaagcttgctcccggtgagtgtaaagtgtttatatgtaaataa

DBGET integrated database retrieval system