KEGG   Butyrivibrio fibrisolvens: CIY_01200Help
Entry
CIY_01200         CDS       T02581                                 

Definition
(GenBank) acetyl-CoA acetyltransferases
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bfi  Butyrivibrio fibrisolvens
Pathway
bfi00071  Fatty acid degradation
bfi00280  Valine, leucine and isoleucine degradation
bfi00310  Lysine degradation
bfi00362  Benzoate degradation
bfi00380  Tryptophan metabolism
bfi00620  Pyruvate metabolism
bfi00630  Glyoxylate and dicarboxylate metabolism
bfi00640  Propanoate metabolism
bfi00650  Butanoate metabolism
bfi00900  Terpenoid backbone biosynthesis
bfi01100  Metabolic pathways
bfi01110  Biosynthesis of secondary metabolites
bfi01120  Microbial metabolism in diverse environments
bfi01130  Biosynthesis of antibiotics
bfi01200  Carbon metabolism
bfi01212  Fatty acid metabolism
bfi02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bfi00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    CIY_01200
   00630 Glyoxylate and dicarboxylate metabolism
    CIY_01200
   00640 Propanoate metabolism
    CIY_01200
   00650 Butanoate metabolism
    CIY_01200
  Lipid metabolism
   00071 Fatty acid degradation
    CIY_01200
   00072 Synthesis and degradation of ketone bodies
    CIY_01200
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CIY_01200
   00310 Lysine degradation
    CIY_01200
   00380 Tryptophan metabolism
    CIY_01200
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CIY_01200
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CIY_01200
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    CIY_01200
Enzymes [BR:bfi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CIY_01200
Exosome [BR:bfi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CIY_01200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: CBK73101
UniProt: D4IZ12
Position
complement(99560..100711)
Genome map
AA seq 383 aa AA seqDB search
MGGSLSNTPAVDLGAIVIKEAVKRAGIKPEDVEHVYMGCVIQAGLGQNVARQAAIKAGLP
NETTAVTTNVVCGSGLNCVNQAAQMILAGDADVVVAGGMENMSLAPFALPNGRFGYRMTW
PSNSQGALVDTMVKDALWDAYNDYHMIKTADNVAEQWKLTREELDEFAVNSQNKACKAIE
SGAFKDEIVPVEIKKKKETVLFDTDEGPRPGTTMEGLAKLKALYPNGVVTAGNASGINDG
AAALVVMSEEKAKELGVKPLVTFVAGALGGCAPEIMGVGPVPATKKALAKAGLTIDDLDV
YEANEAFAAQSVAVGKELGFDLNKLNPNGGAIALGHPVGASGARILVTLIYDMIHNPEYK
KGLATLCIGGGMGCATIVEKYEG
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgggcggatcacttagcaacactccagcagtagacttaggtgctatcgtaattaaggaa
gcagttaagagagctggtatcaagccagaggacgtagagcacgtatatatgggatgcgtt
atccaggcaggtttaggacagaacgttgctcgtcaggcagctatcaaggctggtcttcct
aacgagacaacagcagttacaacaaacgttgtttgtggttctggtcttaactgtgttaac
caggctgcacagatgatccttgcaggtgatgctgatgtagtagtagcaggtggtatggag
aacatgtcactcgctccattcgcacttccaaatggacgttttggttacagaatgacttgg
ccatcaaacagccagggtgctttagtagatacaatggttaaggatgctctttgggatgca
tacaatgactaccacatgatcaagacagctgataacgtagctgagcagtggaagcttaca
agagaagagcttgatgagtttgctgttaactcacagaacaaggcttgcaaggctatcgaa
tctggtgcattcaaggatgaaatcgttcctgtagaaatcaagaagaagaaggaaacagtt
cttttcgatacagatgaaggcccaagacctggtacaacaatggaaggtcttgctaagctt
aaggctctttatccaaacggtgttgttacagctggtaatgcttcaggtatcaacgatggt
gcagctgcactcgtagttatgtctgaggagaaggctaaggaacttggtgttaagccactt
gttactttcgtagctggtgctcttggcggatgcgctccagaaatcatgggtgttggtcca
gttcctgcaacaaagaaggctcttgctaaggctggtcttacaattgatgatcttgatgtt
tacgaagcaaacgaagcatttgctgcacagtcagtagcagtaggtaaggagcttggcttc
gaccttaacaagctcaatccaaacggtggtgctatcgcacttggtcacccagtaggagct
tcaggtgctcgtattcttgtaacacttatttacgatatgatccacaacccagagtacaag
aagggtcttgctactctttgcatcggtggcggtatgggttgcgcaactatcgtagaaaag
tatgaaggttaa

DBGET integrated database retrieval system