KEGG   Butyrivibrio fibrisolvens: CIY_07220Help
Entry
CIY_07220         CDS       T02581                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
bfi  Butyrivibrio fibrisolvens
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bfi00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CIY_07220
Enzymes [BR:bfi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     CIY_07220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
659379..660938
Genome map
AA seq 519 aa AA seqDB search
MKRSSGILLPISSLPSPYGIGTFGKAAYDFADFLKASGQKYWQVLPLGPTSYGDSPYQSF
STFAGNPYFIDLETLIEEGLLTKKEVEAENWGTNPRYVDYGQIYESRFKILEKAKERGCK
DSLGDIALFRKQNAWVENYALFMSIKKHFGQLSWQEWPEEDIRLHEKKAVEKYTKELAED
IEFYIYIQYLFFKQWAKLKTYINSLGIEVIGDLPIYVALDSCDVWAEPEFFSLDDENYPV
EVAGVPPDYFSETGQLWGNPCYDWKAMKKDNYRWWIRRIDGASKLYDVLRIDHFRGFDEY
WAVPAKEKTAKRGKWKKGPGMDLVGLLSKTFPNIEFIAEDLGEPSPTVVKLLQDSGWPGM
KVLEFAFDSGEANNYQPHSYDKNCVCYTGTHDNATVMEWYEDADKKDRDYASKYLGISKS
EGFNWGLIRGGMSSVAVLFVAQMQDFLGLGKYNRINVPGTDSGNWQWRLLAKEPTTELAK
KIFDMSLLYERTTKPPKPKKPEKPQKPQKKQAKKASSKK
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagaagtagcggaatattgctccctatatcttcattaccatccccatatggtatt
ggtacctttggaaaggctgcttatgattttgcagattttttaaaggcatctggccagaag
tattggcaggtacttccactggggcctactagttacggagatagtccatatcagagtttt
tcaacttttgcaggaaatccatatttcattgatctggaaactcttatagaagaaggtctt
cttacaaagaaggaagtagaggctgaaaactggggcaccaatcctcgttatgttgactat
ggtcaaatctatgaaagtcgtttcaaaattttagaaaaggctaaggaaagaggatgcaag
gattctttaggcgatattgccttattcagaaagcaaaatgcgtgggttgagaattatgct
ttgtttatgtctataaaaaagcattttggacagctgagctggcaggaatggccagaggaa
gatattcgtcttcacgagaaaaaggctgttgaaaaatatactaaagagctggctgaggat
attgaattttatatttacattcagtatctgttcttcaaacagtgggcaaagctaaagacc
tatattaatagccttggcatagaggtaattggagatttacctatatatgttgcccttgat
tcctgtgatgtttgggccgagccagagtttttcagtttagatgatgaaaactaccctgta
gaggtagctggtgttccaccagattatttcagtgaaacaggccagctttggggcaatcct
tgctacgattggaaggctatgaaaaaagacaactatcgttggtggattcgcagaatcgat
ggagcttcaaagctctatgatgttcttagaattgatcactttagaggttttgatgagtac
tgggctgttccagcaaaggaaaagacagctaaaagaggaaagtggaagaagggaccagga
atggatttggtgggccttctttcaaagaccttccctaacatagagtttattgcagaggat
ttaggtgagccttctcctacagttgtaaagctgcttcaggatagtggctggccaggaatg
aaggtccttgaatttgcgtttgactcaggtgaggcaaataattatcagcctcatagctat
gataaaaactgtgtctgctacactggtacccatgataatgcaacagttatggagtggtat
gaggatgcagacaaaaaggacagggattacgcctccaagtatttaggaatctcaaaatca
gagggattcaactggggacttataagaggtggaatgtcatctgtagccgttttatttgtg
gcacagatgcaggatttcttaggccttggcaagtacaatcgtattaatgtgcctggtaca
gatagtggtaactggcagtggagattacttgcaaaggagccaactacagagctggctaag
aaaatttttgatatgtctcttctttacgagagaacaacaaaaccaccaaagccaaagaaa
ccggaaaaaccacaaaaaccacaaaagaaacaagcaaagaaagcttcttcaaaaaaataa

DBGET integrated database retrieval system