KEGG   Butyrivibrio fibrisolvens: CIY_12020Help
Entry
CIY_12020         CDS       T02581                                 

Definition
Glycosidases (EC:2.4.1.7)
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
bfi  Butyrivibrio fibrisolvens
Pathway
Starch and sucrose metabolism
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:bfi00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1110708..1112123
Genome map
AA seq 471 aa AA seqDB search
MKKLENKCMLITYADSMGDNLSDLTTVMNKHFKDAVGGIHILPFFPSSGDRGFAPMDYHV
VDPAFGDWNDIEKLAEDYYLMADYMINHISAQSEYYKDFLAKKDDSKYKDLFIRYKDFWE
NGEPTEEEVDAIYKRKPRAPYVDANFADGTTEKVWCTFDEQQIDINCKSATAKEFIKDNL
ETLCKHGLAMIRLDAFAYATKKAGSSCFFIEPEVWELMDESAKIVEPYGVTLLPEIHEHY
TMQQKIESHDYYVYDFALPMLLINGLYYGQSQYLKHWLEICPRKQFTTLDTHDGIGVVDV
KDLLPDEEIERTKEDIFKFGANVKKIYNTAAYNNLDIYQVNCSYYSALGDDDDAYLLARA
VQFFAPGIPQVYYVGLLAGKNDLQLLEETKVGRNINRHYYKLDEIDREVERPVVKKLLEL
MKFRNEHSAFDGEFILEDCSDEELVILRKNGDAFARLKANLKTKKFTIEHS
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagctagaaaacaaatgtatgcttatcacttatgcagattctatgggtgataac
ctttcagatttaacaacagtaatgaacaagcattttaaggatgcggttggtggaattcac
attcttccatttttcccttcatcaggagacagaggttttgctccaatggattaccacgta
gtagacccagcttttggtgattggaatgatattgaaaagttggcagaagattactatctt
atggctgattatatgattaaccatatttcagcacagagtgaatactataaggatttcctt
gcaaagaaggatgattctaagtacaaggatctttttatccgttacaaggatttctgggag
aatggagaaccaacagaggaagaagtagatgctatctacaagagaaagccaagagctcca
tacgtagatgcgaatttcgcagacggcactactgagaaggtttggtgtacatttgatgag
cagcagattgatatcaactgcaagtcagctactgcaaaggaattcatcaaggataatctt
gaaacactttgtaagcatggtcttgctatgattagacttgatgcattcgcatatgctaca
aagaaggcaggctcttcatgctttttcattgagccagaggtttgggagcttatggatgaa
tcagcaaagattgttgagccatatggtgtaacacttcttccagagattcacgagcactat
acaatgcagcagaagattgaaagtcatgattactatgtatatgattttgcgcttcctatg
cttcttattaacggcctttactatggacagtcacagtacttaaagcactggcttgagatt
tgcccaagaaagcagtttacaacacttgatacacacgatggaatcggagttgtagacgtt
aaggatcttcttcctgatgaggaaatcgaacgtacaaaggaagacatctttaaattcggc
gctaatgttaaaaagatttataacacagcagcttacaacaaccttgatatttatcaggtt
aactgcagctactattcagcacttggagatgatgacgatgcttatcttcttgcgagagca
gtacagttctttgcaccaggtattccacaggtatactatgtaggactccttgcaggaaag
aacgaccttcagcttttagaggagacaaaggttggtagaaatattaatcgtcattactat
aagcttgatgaaatcgaccgcgaggttgaaagaccagtagttaagaaattacttgagctt
atgaagtttagaaatgagcattcggcatttgatggggagtttattttagaggattgcagc
gatgaagagcttgtaattcttagaaaaaatggtgacgcttttgcaagacttaaggctaac
ttaaaaactaagaagttcactattgaacattcataa

DBGET integrated database retrieval system