KEGG   Butyrivibrio fibrisolvens: CIY_12200Help
Entry
CIY_12200         CDS       T02581                                 

Definition
Glycosidases
Orthology
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
bfi  Butyrivibrio fibrisolvens
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bfi00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CIY_12200
Enzymes [BR:bfi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     CIY_12200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1134477..1138478
Genome map
AA seq 1333 aa AA seqDB search
MIKMGKMAKRFVAVAMSLAMVAGIPGANLKAFATPGIDSVQAASAVSRSSIHDGSILHAF
CWNFNTIKEKMPEIAAAGYTAVQTSPINECLSIHNGMALYGDTEDEGRWYYHYQPTDWKI
GNYQLGSRDEFKAMCDEADKYGIGVIVDIDPNHTTPVFDQVSDDLKAAAGGEDSLYHIGA
KDGGMAYDNRISVTYDAMGGLPDVDTENPGFQNYFYEFLQDCIACGADGFRIDTAKHIAL
PDDGVAEEYAGQEGRNNFYPNMKASINEKAAKSYDDLFVYGEVLDGDAARLAAYQDMLGG
TCASNYGGAIRNAASSGNVSVKKLLNYKISDDTSTGTTYTADSNKLVTWVESHDNYINDK
SYNEVDDREVILGWAIITARADGTPLFFSRPEGSSAENPWGANRIGDAGSDIYKAPEVVA
VNKFRTAMEGLSENLRNPGNNSSILMIERGNKGVVIVNASENDFALDSETNLSDGTYVDS
VEGRTGLYTVSDGNIYGTVPAKSVVVLDTLADGDYSTIFFHNTDGWNSVSAIACDNTFAC
DYTQDNWWKVTIPAKEFKVTFTDGEKQSAEFSIGADTGRFMTAKSDKIYGSKAEAEEALG
IVTKTVYFLNSEEWKSVYAYAWTDATQHLGGWPGAPIVNEEGYWWKADVKMIGDQNFSII
FNNNEGSQTVDIPMDDMSKNVITISAEQPGGNLVVDRYSSKAEAEEATGINGTSTTVHFY
DAAGWGKVGVYTWGDVDLGGWPGAECEYEGDGWWKKTINCGPSSNFNIIFNNMPTGDDDK
RQTDDMKCDSLKKVYFIGANYKYGSKAAALDALANDNLKLEKNLHPELNPVEEPTDRPVE
EEPVLGEDEVKIYYYNTANWDNVNMYAWTDGANTEYFGGWPGKAMQHIGGNWYSVSVNKA
ALTHEGLHLIANNGDGEQINDVALISERPNIEEKPSEPDKPAPSEPEEPTEPEKKLKPIQ
EEEADKEGYTKIYIQLDVDKFPEAANLYAWAEGVGDIDGIGGWPGLSMTHIGNGWHSINF
PDKYLNKAEEVSEEASEEKVEDEKSEVVTDDTTKEVVENNEVEETEKASDEVISEEESQE
PEEDSLVEEVREILTSLVNLITSAFNPLEVKAAEHQTFADGIHLIVNNGNGYQEDDVNAR
FTTVRPSAEELKQEEELVVEPTPAPAPAPQPGGASGNGGSSSGSSSSSGSSASSGSASAT
PAQQIASIAESQVPLGVSPVKVVEDSSVVKKVASKVRKSTSKSKEVSAEEEAVDTTSEVE
TEESVELPDAEIPEVDEAETTEPEKEEVRIVDEGVPEAAVDTGSSNLAVIILIIVAAVVI
IGGAGFVVVRKRK
NT seq 4002 nt NT seq  +upstreamnt  +downstreamnt
atgataaaaatgggaaaaatggcgaagagattcgtcgcagttgccatgtcacttgctatg
gtagctggaattcctggtgcaaatcttaaagcatttgctacaccggggattgattcagtt
caggcagcatcagctgttagcagatcatcaattcatgatggttcaatcctacatgcattt
tgttggaattttaatactataaaggagaagatgccagagatagcagcagctggatacaca
gcagttcagacatctccaatcaatgaatgtctttctattcataatggaatggctctttac
ggagacacagaagatgaaggtcgctggtactatcattatcagcctactgattggaagatt
ggaaactatcagcttggttctcgtgatgaatttaaggctatgtgtgatgaggcagataag
tatggcatcggcgtaatcgttgatatcgatccaaatcatactacgcctgtatttgaccag
gtatcagatgatttgaaggctgcagcaggtggcgaagacagtctttatcacatcggcgct
aaggacggtggtatggcatatgataatcgtatttccgttacttatgatgccatgggtggt
cttccagatgtagatacagaaaatccaggattccagaattacttctacgaatttcttcag
gactgtattgcttgtggtgcagatggatttagaatcgatactgctaagcacatcgcactt
ccagatgatggtgttgcagaggagtacgctggacaggaaggcagaaataatttctatcca
aatatgaaagcctctattaatgagaaggctgcaaagtcatatgatgatttatttgtctat
ggtgaggtccttgatggtgatgcagctagacttgctgcatatcaggatatgcttggtgga
acctgtgccagcaactacggcggagcaatcagaaacgctgcaagctccggtaatgtttca
gtaaagaagctcttaaactacaaaatcagtgacgatacatcaacaggaactacttacaca
gctgattcaaacaaacttgttacctgggtagagtctcacgataactacattaatgacaag
agctacaatgaggttgatgacagagaggtaatccttggctgggcaatcattacagcaaga
gcagatggaacaccacttttctttagccgtccagaaggaagcagtgcagaaaatccttgg
ggtgcaaaccgcataggcgacgcagggtctgatatttacaaagcaccagaggtagttgct
gttaacaagtttagaacagcaatggaaggactttctgagaatcttagaaacccaggaaat
aattcttcaatccttatgattgaaagaggaaacaagggtgttgtaattgtaaatgccagc
gaaaatgattttgctcttgattctgagactaatctttcagatggtacatatgtagattct
gttgaaggaagaactggactttacacagtatcagatggaaatatctatggcacagtacct
gccaagtcagttgttgtacttgatacattagctgacggagactattccacgatcttcttc
cacaataccgacggttggaatagcgttagcgctattgcttgcgataatacttttgcttgt
gattatacacaggacaattggtggaaggttacaattccagcgaaggaattcaaagtaaca
tttacagatggtgaaaaacagtctgctgaatttagcattggcgcagataccggcagattt
atgacagcaaaatcagataagatatatggaagcaaggctgaggccgaggaggctcttggc
attgttacaaagacagtgtatttccttaactcagaggaatggaaatccgtatatgcgtat
gcttggacagatgctacacagcatttaggtggttggccaggtgcaccaattgttaatgaa
gaaggctactggtggaaggctgatgttaagatgattggcgaccagaacttctcaatcatt
ttcaacaacaatgagggctctcagaccgttgatattccaatggatgatatgagcaaaaac
gtaattaccatatctgctgaacagcctggtggaaatcttgtagtagatagatattcatca
aaggctgaggcagaagaagctacaggtattaacggaacttccacaacagttcacttctat
gatgcagctggttggggaaaagttggtgtttatacctggggagatgtggatttaggcggc
tggccaggagcagaatgtgaatatgaaggtgatggctggtggaaaaagacaattaattgc
ggaccaagctcaaatttcaacatcatcttcaataatatgccaacaggagatgatgacaag
cgccagacagatgatatgaagtgtgacagcctaaagaaggtttacttcatcggtgctaat
tataagtatggttcaaaggcagctgctcttgatgcacttgcaaatgacaatcttaagtta
gagaagaatcttcatccagagctgaatcctgtggaagagcctacagacagacctgttgag
gaagagccagtattaggtgaagatgaagtaaaaatctactactacaatactgctaactgg
gataatgtaaatatgtatgcctggacagatggtgccaacactgaatattttggtggctgg
ccaggaaaagctatgcagcatatcggtggtaactggtattcagtaagtgtaaataaagct
gcattaacacacgaaggtttacatctcattgcaaacaatggagatggagagcagattaat
gatgtggctcttatttctgagagaccaaatattgaagagaagccttctgagccagataag
ccagcaccatctgagccagaggaacctactgagcctgagaagaagcttaagccaattcag
gaggaagaggctgataaggaaggatatacaaagatttatattcagcttgatgtagataag
ttcccagaggcagcaaatctctatgcttgggcagagggagttggtgatatcgatggaatc
ggtggctggccaggactttcaatgactcatattggaaatggatggcacagcatcaacttc
ccagataagtatttaaataaggctgaggaagtttcagaagaagcatctgaggaaaaagta
gaggatgagaaatctgaagttgtaacagatgatactacaaaagaagttgttgaaaataac
gaggttgaagagacagaaaaagcttctgatgaagtgatttctgaggaagagtcacaggag
ccagaagaggattcgcttgttgaagaggttagggagattttaacatcacttgttaatctc
atcacttctgcattcaatcctttagaggtaaaggctgctgagcatcagacatttgctgat
ggaatccatctcatcgtaaacaacggcaatggatatcaggaagatgatgtaaatgcaaga
tttacaacagttcgtccaagtgcagaggaattaaagcaggaagaggaacttgttgtagag
cctacaccagcccctgcaccagcaccacagcctggcggagcttctggaaatggcggttca
tcttctggaagtagctcatcctcaggcagtagtgcttcttctggaagtgcttcggctact
ccagcacagcagattgcatcaatcgctgaaagccaggtcccacttggcgtatcacctgtt
aaggttgtagaggacagcagtgttgtaaagaaggtggcatctaaggttagaaagagcact
tctaaatcgaaagaggtgtctgctgaggaagaagcagtggatactacatcagaggttgag
actgaagaatctgtagagcttccagatgcagaaatcccagaggttgatgaagctgagact
acagaacctgaaaaagaagaagtaagaattgttgacgagggtgtgcctgaggcagcagta
gatacaggcagctcaaatcttgcagtaattatcttaattattgtagctgcagttgttatt
attggcggcgcaggatttgtggttgtgcgcaagagaaaataa

DBGET integrated database retrieval system