KEGG   Butyrivibrio fibrisolvens: CIY_15800Help
Entry
CIY_15800         CDS       T02581                                 

Definition
Alpha-galactosidase (EC:3.2.1.22)
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
bfi  Butyrivibrio fibrisolvens
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:bfi00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:bfi00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:bfi00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1481150..1483486
Genome map
AA seq 778 aa AA seqDB search
MIKADGKVFVLNTKNTTYAFRVMETGQLEHLYYGGLIQEDEPSVLKEKRAFAPGNTVTYD
AEHPELTLEDVRLETSAIGKGDYREPMVEVVCADGSSTLDFIYDSYQVINCKPELEGLPS
SYDEDDAAKTLEITLKDKNHGLTLKLSYSVFEECDVITRSAKFINTSNETVKLTRMLSML
LDFDKPGLKVTSFHGSWTREMNKSDVILTAGKLVNSSFTGTSSNRCNPFFMVSDADATET
DGDVYGFNLVYSGNHYSATEVSPWGKTRVAYGINPQNFSWTLEAGEEFQAPEAVITYSGA
GFRQMSLNMHEFVREHITRGVWKHKERPVLINSWEASYFDFTEKSLVKLAKTAKDTGIEL
FVMDDGWFGDRNDDKRALGDWDIINKKKLPGGLEGLSKKINDLGLMFGLWVEPEMINVDS
ELYRKHPEWAIDIPGMNHAEGRNQRLLDLCNPEVVDYMIDRMSEVFATPGLSYIKWDMNR
NFSDYYSKYLPAEKQQEVGHRYVLGFYRLLRTLAEKFPNILMEGCASGGNRFDLGALCYY
PQIWASDNTDAVSRLVIQNGYSYGYPQCTYTAHVSACPNHQTLRVTPIESRFAVASFGVL
GYELNLNDVSSEDIASVKAQIELYKSYRKTLQFGDFYRLKDGNIYEWSIVDKNKETAVTM
LMQREIMAGEQYLRIEQVGLDNDTKYHFFGRKLEYNLKGFGDLVNTVAPVHIKQDGVLHN
VIAKFVKMPGESEDFVASGSTLNNAGVKLAQSFVGTGYNDQVRYFPDFGARLYFVEKE
NT seq 2337 nt NT seq  +upstreamnt  +downstreamnt
atgattaaagctgatggtaaggtatttgttttaaatactaaaaatactacatacgcattt
cgtgtaatggagacaggtcagctggaacatttgtattacggagggctcatccaggaggat
gagccatctgtgcttaaggaaaaacgtgcatttgctccaggaaatactgttacatacgat
gctgaacatccagagcttactttagaggatgttagacttgagacttcagccattgggaag
ggtgattatagagagcctatggtggaggtagtctgcgcagatggaagcagcactcttgat
tttatctacgatagctatcaggtgataaattgcaagccagagcttgaaggacttcctagc
tcatatgacgaggatgacgctgcaaagactcttgaaataacacttaaagataagaatcac
ggactaacactaaagctttcatattctgtttttgaagagtgcgatgttatcactcgaagc
gctaagttcatcaacacctctaacgagacagttaagctgacacgtatgctttccatgctt
cttgattttgataaaccaggacttaaggttacttctttccatggttcatggacaagggaa
atgaacaagtcggatgttattcttactgcaggaaagcttgttaattcttcatttacaggt
accagctctaacagatgcaatccattctttatggtatcagatgctgatgctacagagact
gatggggatgtgtacggatttaacctggtatattcaggtaatcattattctgctacagag
gtttcaccttggggcaagaccagagtggcgtatggtataaatcctcagaacttctcttgg
actcttgaggcaggagaggaattccaggcgccagaggcagttattacatattctggtgct
ggatttagacaaatgagcttgaatatgcatgaatttgttcgtgaacatattaccagaggt
gtttggaaacataaggagcgcccagtccttattaatagctgggaggcatcatattttgac
tttacagaaaagtctcttgtaaagctggctaagaccgcaaaggacacaggcatagaattg
tttgttatggatgatggctggtttggagatagaaatgacgataaacgagcactaggcgac
tgggatatcattaacaaaaagaagcttcctggtggcttagaaggactgtctaagaagatt
aatgatcttggtcttatgtttggtctttgggtagagcctgagatgattaacgtagacagc
gagctttatcgtaaacatcctgaatgggctatcgacatcccaggaatgaatcatgcagaa
ggacgtaatcagcgtctccttgatctttgcaacccagaagttgtggattatatgattgac
agaatgagtgaagtttttgctactcctggactttcatacatcaaatgggatatgaaccgt
aatttctcggattattattcaaagtatcttccagctgaaaagcagcaggaggttggtcac
agatatgttcttggattctatcgtcttcttagaacacttgctgagaaattccctaacata
cttatggagggatgcgcttcaggtggaaatagatttgatcttggagccctttgctactac
ccacagatttgggccagcgataacacagatgcagtcagccgtcttgtaattcagaatgga
tattcatatggctatccacagtgtacatacacagcccatgtatctgcctgtcctaatcat
cagactcttcgtgtaacacctatcgaaagccgatttgcagtagcaagctttggtgttctt
ggatacgagcttaatcttaatgacgtaagttcagaggacattgctagtgttaaggctcag
attgaactttacaaatcctacagaaagactcttcagtttggtgatttctaccgtctaaag
gatggaaacatctacgagtggagtattgtagataagaataaagaaactgctgtaactatg
cttatgcagcgagagattatggcaggagaacagtatcttagaatagaacaggttggtctt
gataatgatacaaagtaccatttcttcggcagaaagctagaatacaatctcaagggcttt
ggagatttggtaaatactgttgcaccagttcatatcaagcaagatggtgtacttcacaat
gtcattgccaagttcgtaaaaatgccaggggaatcagaggacttcgtagccagcggctca
actcttaacaacgcaggtgtaaagcttgctcagtccttcgtaggaacaggctataacgat
caggttcgttacttcccagactttggagcacgtctgtacttcgtagaaaaagaatag

DBGET integrated database retrieval system