KEGG   Butyrivibrio fibrisolvens: CIY_16470Help
Entry
CIY_16470         CDS       T02581                                 

Definition
(GenBank) Glycosyl hydrolase family 9.
  KO
K01179  endoglucanase [EC:3.2.1.4]
Organism
bfi  Butyrivibrio fibrisolvens
Pathway
bfi00500  Starch and sucrose metabolism
bfi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bfi00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CIY_16470
Enzymes [BR:bfi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     CIY_16470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_9
Motif
Other DBs
NCBI-ProteinID: CBK74409
UniProt: D4J2S0
Position
complement(1539258..1540538)
Genome map
AA seq 426 aa AA seqDB search
MLYYQRCGAELKSDCAGDFAHPECHTQKCVLYEDSSKQIDVTGGWHDAGDYGRYSVAGAT
SVADLLLAYENYPKAFDDNVGIPESNNGIPDVLDEARYELEWLLKMQRKDGGVYHKVTCH
NFPGEVMPQDETDELIVMPVSTTATGDFAAVMAMASRIYEKTDKAFADKCLKASKKAAEY
IDKTPTDTKGYRNPSDVTTGEYEDTCDIDERFWAYAELFKTTGDKAYETAMLKELPKNGY
SLGWQGVAGYGAYAYLSAKQAKETKDIKAEAEATAKQIVSYAHSNAYGSSIITSYPWGSN
LTIANNGQFLLLMKEALGNADKDTIDKQLNYLFGNNATGYSFLTGYGTLYPEHPHHRPSQ
ATGKTVPGMIVGGPNSGLDDPYVANVLRGTPAAKCYADNSQSYSTNEITIYWNSPVIYLL
AGEMNQ
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgctctattatcagagatgcggcgcagaactaaaaagtgattgtgccggcgattttgcc
catccagagtgtcacacacaaaaatgcgtgctttacgaggattcatcgaagcagatagac
gtaactggtggctggcatgatgcaggtgattacggaagatattctgtagccggtgctact
tctgtagctgatttactgcttgcctacgaaaattatccaaaggcatttgatgataatgta
ggaataccagaaagtaataatggcatccctgatgttttggacgaagccagatatgagctg
gaatggcttctgaagatgcagcgaaaagacggcggtgtttatcacaaggtaacctgccac
aacttcccaggcgaagtaatgcctcaggatgaaaccgatgagctgattgttatgcctgta
tctacaacagcaactggcgattttgcagcagttatggcaatggcatcacgcatatacgaa
aagacagataaagcctttgcagacaaatgccttaaggcttcaaagaaggctgctgaatat
attgataaaacacctaccgatacaaagggatatagaaatccatctgatgtaacaacaggt
gaatatgaagatacctgcgacatagatgaaagattctgggcctatgccgagctctttaaa
acaacaggtgacaaggcttatgaaacagctatgttaaaagagcttcctaaaaacggctat
agtcttggatggcaaggtgtggctggctatggtgcatatgcatatctttcagcaaagcag
gctaaagaaacaaaagatattaaagctgaggcagaagctactgcaaagcagattgtaagc
tatgctcactcaaatgcctatggctcttctatcatcacaagctatccttggggaagtaac
ctaaccatagcaaacaatggtcaattccttcttttaatgaaagaagcccttggaaatgct
gataaagataccatcgataaacagctcaattatctatttggaaataatgctaccggttac
agcttcttaaccggctatggcacactttatccagagcatccacatcacagaccatcacag
gcaaccggaaaaacagtacctggtatgattgttggaggtccaaacagtgggcttgatgat
ccttatgtagcaaacgtgctaagaggaacgcctgcagcaaaatgctacgcagataactcg
caaagctattctacaaacgagattacaatctactggaattccccagtaatatacctgtta
gcaggtgaaatgaatcaataa

DBGET integrated database retrieval system